Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Spectrin beta chain, brain 1 (Sptbn1) Recombinant Protein | Sptbn1 recombinant protein

Recombinant Mouse Spectrin beta chain, brain 1 (Sptbn1) , partial

Average rating 0.0
No ratings yet
Gene Names
Sptbn1; elf1; elf3; SPTB2; Spnb2; Spnb-2; AL033301; mKIAA4049; 9930031C03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spectrin beta chain, brain 1 (Sptbn1); N/A; Recombinant Mouse Spectrin beta chain, brain 1 (Sptbn1) , partial; Sptbn1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2199-2304aa; Partial
Sequence
MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sptbn1 recombinant protein
Spectrin is an actin crosslinking and molecular scaffold protein that links the plasma membrane to the actin cytoskeleton, and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. It is composed of two antiparallel dimers of alpha- and beta- subunits. This gene is one member of a family of beta-spectrin genes. The encoded protein contains an N-terminal actin-binding domain, and 17 spectrin repeats which are involved in dimer formation. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
251,156 Da
NCBI Official Full Name
spectrin beta chain, non-erythrocytic 1 isoform 2
NCBI Official Synonym Full Names
spectrin beta, non-erythrocytic 1
NCBI Official Symbol
Sptbn1
NCBI Official Synonym Symbols
elf1; elf3; SPTB2; Spnb2; Spnb-2; AL033301; mKIAA4049; 9930031C03Rik
NCBI Protein Information
spectrin beta chain, non-erythrocytic 1
UniProt Protein Name
Spectrin beta chain, non-erythrocytic 1
UniProt Gene Name
Sptbn1
UniProt Synonym Gene Names
Elf; Spnb-2; Spnb2; Sptb2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Sptbn1 sptbn1 (Catalog #AAA117397) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2199-2304aa; Partial. The amino acid sequence is listed below: MEGFLNRKHE WEAHNKKASS RSWHNVYCVI NNQEMGFYKD AKSAASGIPY HSEVPVSLKE AICEVALDYK KKKHVFKLRL SDGNEYLFQA KDDEEMNTWI QAISSA. It is sometimes possible for the material contained within the vial of "Spectrin beta chain, brain 1 (Sptbn1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.