StAR-related lipid transfer protein 7 Recombinant Protein | STAR7 recombinant protein
Recombinant Human StAR-related lipid transfer protein 7, mitochondrial
Gene Names
STARD7; GTT1
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
StAR-related lipid transfer protein 7; N/A; Recombinant Human StAR-related lipid transfer protein 7, mitochondrial; Gestational trophoblastic tumor protein 1START domain-containing protein 7; StARD7; STAR7 recombinant protein
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Partial of the Full Length of 59-370aa, 61-307aa
Sequence
LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV
Product Type
Recombinant Protein
Target Name
STAR7
Tag Info
GST-tag
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56.9kD
NCBI Official Full Name
stAR-related lipid transfer protein 7, mitochondrial
NCBI Official Synonym Full Names
StAR related lipid transfer domain containing 7
NCBI Official Symbol
STARD7
NCBI Official Synonym Symbols
GTT1
NCBI Protein Information
stAR-related lipid transfer protein 7, mitochondrial
UniProt Protein Name
StAR-related lipid transfer protein 7, mitochondrial
UniProt Gene Name
STARD7
UniProt Synonym Gene Names
GTT1; StARD7
Similar Products
Product Notes
The STAR7 stard7 (Catalog #AAA309763) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial of the Full Length of 59-370aa, 61-307aa. The Recombinant Human StAR-related lipid transfer protein 7, mitochondrial reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: LWRRLHGRPG HASALMAALA GVFVWDEERI QEEELQRSIN EMKRLEEMSN MFQSSGVQHH PPEPKAQTEG NEDSEGKEQR WEMVMDKKHF KLWRRPITGT HLYQYRVFGT YTDVTPRQFF NVQLDTEYRK KWDALVIKLE VIERDVVSGS EVLHWVTHFP YPMYSRDYVY VRRYSVDQEN NMMVLVSRAV EHPSVPESPE FVRVRSYESQ MVIRPHKSFD ENGFDYLLTY SDNPQTVFPR YCVSWMV. It is sometimes possible for the material contained within the vial of "StAR-related lipid transfer protein 7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.