Translocated intimin receptor Tir Recombinant Protein | tir recombinant protein
Recombinant Escherichia coli O157:H7 (strain TW14359 / EHEC) Translocated intimin receptor Tir
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translocated intimin receptor Tir; N/A; Recombinant Escherichia coli O157:H7 (strain TW14359 / EHEC) Translocated intimin receptor Tir; Secreted effector protein Tir; tir recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
252-362aa; Partial-length
Sequence
QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG
Species
Escherichia coli O157:H7 (strain TW14359 / EHEC)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for tir recombinant protein
Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion.
References
"Analysis of the genome of the Escherichia coli O157:H7 2006 spinach-associated outbreak isolate indicates candidate genes that may enhance virulence." Kulasekara B.R., Jacobs M., Zhou Y., Wu Z., Sims E., Saenphimmachak C., Rohmer L., Ritchie J.M., Radey M., McKevitt M., Freeman T.L., Hayden H., Haugen E., Gillett W., Fong C., Chang J., Beskhlebnaya V., Waldor M.K. Miller S.I. Infect. Immun. 77:3713-3721(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.8 kDa
NCBI Official Full Name
translocated intimin receptor Tir
UniProt Protein Name
Translocated intimin receptor Tir
UniProt Gene Name
tir
UniProt Synonym Gene Names
espE
UniProt Entry Name
TIR_ECO5T
Similar Products
Product Notes
The tir tir (Catalog #AAA115208) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 252-362aa; Partial-length. The amino acid sequence is listed below: QALALTPEPD SPTTTDPDAA ASATETATRD QLTKEAFQNP DNQKVNIDEL GNAIPSGVLK DDVVANIEEQ AKAAGEEAKQ QAIENNAQAQ KKYDEQQAKR QEELKVSSGA G. It is sometimes possible for the material contained within the vial of "Translocated intimin receptor Tir, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
