Toll-like receptor 4 (Tlr4) Recombinant Protein | Tlr4 recombinant protein
Recombinant Rat Toll-like receptor 4 (Tlr4), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Toll-like receptor 4 (Tlr4); N/A; Recombinant Rat Toll-like receptor 4 (Tlr4), partial; Tlr4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-638aa; partial
Sequence
NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tlr4 recombinant protein
This protein is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96,072 Da
NCBI Official Full Name
toll-like receptor 4
NCBI Official Synonym Full Names
toll-like receptor 4
NCBI Official Symbol
Tlr4
NCBI Protein Information
toll-like receptor 4
UniProt Protein Name
Toll-like receptor 4
UniProt Gene Name
Tlr4
UniProt Synonym Gene Names
Toll4
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Tlr4 tlr4 (Catalog #AAA116620) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-638aa; partial. The amino acid sequence is listed below: NPCIEVLPNI TYQCMDQNLS KIPHDIPYST KNLDLSFNPL KILRSYSFTN FSQLQWLDLS RCEIETIEDK AWHGLNQLST LVLTGNPIKS FSPGSFSGLT NLENLVAVET KMTSLEGFHI GQLISLKKLN VAHNLIHSFK LPEYFSNLTN LEHVDLSYNY IQTISVKDLQ FLRENPQVNL SLDLSLNPID SIQAQAFQGI RLHELTLRSN FNSSNVLKMC LQNMTGLHVH RLILGEFKNE RNLESFDRSV MEGLCNVSID EFRLTYINHF SDDIYNLNCL ANISAMSFTG VHIKHIADVP RHFKWQSLSI IRCHLKPFPK LSLPFLKSWT LTTNREDISF GQLALPSLRY LDLSRNAMSF RGCCSYSDFG TNNLKYLDLS FNGVILMSAN FMGLEELEYL DFQHSTLKKV TEFSVFLSLE KLLYLDISYT NTKIDFDGIF LGLISLNTLK MAGNSFKDNT LSNVFTNTTN LTFLDLSKCQ LEQISRGVFD TLYRLQLLNM SHNNLLFLDP SHYKQLYSLR TLDCSFNRIE TSKGILQHFP KSLAVFNLTN NSVACICEYQ NFLQWVKDQK MFLVNVEQMK CASPIDMKAS LVLDFTNSTC YIYKTIISVS VVS. It is sometimes possible for the material contained within the vial of "Toll-like receptor 4 (Tlr4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.