Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283378_AD13.jpg Application Data (Recombinant Mouse TNFSF15/TL1A Protein induce apoptosis of TF?1 human erythroleukemic cells. The ED<sub>50</sub> for this effect is 15.61-62.44 ng/mL, corresponding to a specific activity of 1.60×10<sup>4</sup>~6.41×10<sup>4</sup> units/mg.)

TNFSF15/TL1A Recombinant Protein | TNFSF15 recombinant protein

Recombinant Mouse TNFSF15/TL1A Protein

Average rating 0.0
No ratings yet
Purity
>95% by SDS-PAGE.
Synonyms
TNFSF15/TL1A; N/A; Recombinant Mouse TNFSF15/TL1A Protein; Tnfsf15, Tl1, Vegi, Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor; TNFSF15 recombinant protein
Ordering
Host
E coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from 0.22 um filtered solution in 20mM PB, 300mM NaCl (pH7.0). Normally 8% trehalose is added as protectant before lyophilization.
Sequence
ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Species
Mouse
Endotoxin
<1EU/ug of the protein by LAL method
Bio-Activity
Measured by its ability to induce apoptosis of TF?1 human erythroleukemic cells. The ED50 for this effect is 15.61-62.44ng/mL, corresponding to a specific activity of 1.60×104~6.41×104 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse TNFSF15/TL1A Protein induce apoptosis of TF?1 human erythroleukemic cells. The ED<sub>50</sub> for this effect is 15.61-62.44 ng/mL, corresponding to a specific activity of 1.60×10<sup>4</sup>~6.41×10<sup>4</sup> units/mg.)

product-image-AAA283378_AD13.jpg Application Data (Recombinant Mouse TNFSF15/TL1A Protein induce apoptosis of TF?1 human erythroleukemic cells. The ED<sub>50</sub> for this effect is 15.61-62.44 ng/mL, corresponding to a specific activity of 1.60×10<sup>4</sup>~6.41×10<sup>4</sup> units/mg.)

SDS-PAGE

(Recombinant Mouse TNFSF15/TL1A Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25 kDa and 20-25 kDa, respectively.)

product-image-AAA283378_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse TNFSF15/TL1A Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 20-25 kDa and 20-25 kDa, respectively.)
Related Product Information for TNFSF15 recombinant protein
TL1A is a type II transmembrane protein belonging to the TNF superfamily and has been designated TNF superfamily member 15 (TNFSF15). Mouse TL1A is a 252 amino acid residues (aa) protein consisting of a 35 aa N-terminal cytoplasmic domain, a 24 aa transmembrane region and 193 aa C-terminal extracellular domain. TL1A is expressed predominantly in endothelial cells and its expression is stimulated by TNF-a and IL-1a. Non-endothelial cells of the gut mucosa, including lamina propria lymphocytes and tissue macrophages, also express TL1A and at higher levels in chronic inflammatory bowel disorders. TL1A binds with high affinity to death receptor 3 (DR3), which is now designated TNF receptor superfamily member 25 (TNFRSF25). DR3 was formerly designated TNFRSF12 when it was thought to be the receptor for TWEAK/TNFSF12. Depending on the cell type, DR3-TL1A interactions have different effects. Ligation of DR3 on activated T cells by TL1A provides a costimulatory signal to increase IL-2 responsiveness and the secretion of proinflamatory cytokines. The promotion of survival of activated T cells by TL1a results from the activation of the transcription factor NF-kappa-B. In a tumor erythroleukemic cell line, TF-1, DR3-TL1A signaling increases production of the NF-kB-dependent antiapoptotic protein c-IAP2, promoting survival in these cells. In HUVEC cells, which express both DR3 and TL1A, ligation of DR3 by TL1A regulates cell apoptosis. These effects of TL1A are blocked by the secreted, soluble decoy receptor 3 (DcR3), also known as TR6 and TNFRSF6B, which compete with DR3 for binding to TL1A. Consistent with the observed in vitro activities, TL1A promotes ex vivo splenocyte expansion and enhances in vivo graft-versus-host-response. The level of TL1A in cells of gut mucosa, in patients with bowel inflammatory disorders, correlates with the severity of inflammation, and TL1A may play a role in a Th1-mediate pathological conditions such as Crohn's disease.
Product Categories/Family for TNFSF15 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 15
UniProt Gene Name
Tnfsf15
UniProt Synonym Gene Names
Tl1; Vegi
UniProt Entry Name
TNF15_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TNFSF15 tnfsf15 (Catalog #AAA283378) is a Recombinant Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ITEERSEPSP QQVYSPPRGK PRAHLTIKKQ TPAPHLKNQL SALHWEHDLG MAFTKNGMKY INKSLVIPES GDYFIYSQIT FRGTTSVCGD ISRGRRPNKP DSITVVITKV ADSYPEPARL LTGSKSVCEI SNNWFQSLYL GAMFSLEEGD RLMVNVSDIS LVDYTKEDKT FFGAFLL. It is sometimes possible for the material contained within the vial of "TNFSF15/TL1A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.