Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115777_SDS_PAGE15.jpg SDS-PAGE

Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial Recombinant Protein | TRPA1 recombinant protein

Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial

Gene Names
TRPA1; ANKTM1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial; N/A; Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial; Recombinant Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial; Transient receptor potential cation channel subfamily A member 1; Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120; TRPA1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
957-1119aa; Partial
Sequence
IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA115777_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for TRPA1 recombinant protein
Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function . Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes . Is also activated by menthol (in vitro). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana . May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).
Product Categories/Family for TRPA1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.2 kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily A member 1
NCBI Official Synonym Full Names
transient receptor potential cation channel, subfamily A, member 1
NCBI Official Symbol
TRPA1
NCBI Official Synonym Symbols
ANKTM1
NCBI Protein Information
transient receptor potential cation channel subfamily A member 1; transformation-sensitive protein p120; ankyrin-like with transmembrane domains 1; ankyrin-like with transmembrane domains protein 1
UniProt Protein Name
Transient receptor potential cation channel subfamily A member 1
UniProt Gene Name
TRPA1
UniProt Synonym Gene Names
ANKTM1
UniProt Entry Name
TRPA1_HUMAN

Similar Products

Product Notes

The TRPA1 trpa1 (Catalog #AAA115777) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 957-1119aa; Partial. The amino acid sequence is listed below: IGLAVGDIAE VQKHASLKRI AMQVELHTSL EKKLPLWFLR KVDQKSTIVY PNKPRSGGML FHIFCFLFCT GEIRQEIPNA DKSLEMEILK QKYRLKDLTF LLEKQHELIK LIIQKMEIIS ETEDDDSHCS FQDRFKKEQM EQRNSRWNTV LRAVKAKTHH LEP. It is sometimes possible for the material contained within the vial of "Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.