Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial Recombinant Protein | USP7 recombinant protein

Recombinant Human Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial

Cat. Num. AAA116548

• Gene Names: USP7; TEF1; HAUSP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial; N/A; Recombinant Human Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial; Ubiquitin carboxyl-terminal hydrolase 7; EC=3.4.19.12; Deubiquitinating enzyme 7; Herpesvirus-associated ubiquitin-specific protease; Ubiquitin thioesterase 7; Ubiquitin-specific-processing protease 7; USP7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 214-521; Partial
• Sequence: VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE
• Sequence Length: 521

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for USP7 recombinant protein

Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN and DAXX. Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis. Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1: acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1. Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like complex. Able to mediate deubiquitination of histone H2B; it is however unsure whether this activity takes place in vivo. Exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function

NCBI and Uniprot Product Information

• NCBI GI #: 150378533
• NCBI GeneID: 7874
• NCBI Accession #: NP_003461.2
• NCBI GenBank Nucleotide #: NM_003470.2
• UniProt Accession #: Q93009; A6NMY8; B7Z815; H0Y3G8
• Molecular Weight: 55.6 kDa
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 7 isoform 1
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 7 (herpes virus-associated)
• NCBI Official Symbol: USP7
• NCBI Official Synonym Symbols: TEF1; HAUSP
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 7; ubiquitin thioesterase 7; deubiquitinating enzyme 7; ubiquitin-specific-processing protease 7; herpesvirus-associated ubiquitin-specific protease; Herpes virus-associated ubiquitin-specific protease; ubiquitin specific protease 7 (herpes virus-associated)
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 7
• UniProt Gene Name: USP7
• UniProt Synonym Gene Names: HAUSP
• UniProt Entry Name: UBP7_HUMAN