Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79315_AD13.jpg Application Data (Binding of recombinant human Wnt5a [Cat# AAA79315] to recombinant human sROR2 in a functional ELISA. sROR2 was coated with 2ug/ml (100ug/well) and increasing amounts of Wnt5a was added. Detection was performed using a polyclonal rabbit anti-human Wnt5a and a goat anti-rabbit Biotin conjugated secondary antibody.)

Wnt-5a recombinant protein

Human Wnt-5a

Average rating 0.0
No ratings yet
Gene Names
WNT5A; hWNT5A
Reactivity
Human
Purity
> 90% by SDS-PAGE & Coomassie stain
Synonyms
Wnt-5a; N/A; Human Wnt-5a; Wnt-5a recombinant protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
> 90% by SDS-PAGE & Coomassie stain
Form/Format
Sterile filtered protein solution was lyophilized from 50 mM acetic acid, free stabilizers and preservatives
Sequence
Protein Sequence: MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELS TCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHHH
Sequence Length
328
Species
Human
Reconstitution
The lyophilized Wnt5a should be reconstituted in water to a concentration of 0.1 mg/ml.
Preparation and Storage
Store at 2-8 degree C for up to 1 week or prepare for extended storage
After initial reconstitution, prepare and store working aliquots at -20 degree to -80 degree C.
Avoid repeated freeze/thaw cycles

Application Data

(Binding of recombinant human Wnt5a [Cat# AAA79315] to recombinant human sROR2 in a functional ELISA. sROR2 was coated with 2ug/ml (100ug/well) and increasing amounts of Wnt5a was added. Detection was performed using a polyclonal rabbit anti-human Wnt5a and a goat anti-rabbit Biotin conjugated secondary antibody.)

product-image-AAA79315_AD13.jpg Application Data (Binding of recombinant human Wnt5a [Cat# AAA79315] to recombinant human sROR2 in a functional ELISA. sROR2 was coated with 2ug/ml (100ug/well) and increasing amounts of Wnt5a was added. Detection was performed using a polyclonal rabbit anti-human Wnt5a and a goat anti-rabbit Biotin conjugated secondary antibody.)

SDS-PAGE

(SDS-PAGE analysis of recombinant human Wnt5a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)

product-image-AAA79315_SDS_PAGE15.jpg SDS-PAGE (SDS-PAGE analysis of recombinant human Wnt5a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)
Related Product Information for Wnt-5a recombinant protein
Wnt-5a is one of the most highly investigated non-canonical Wnts and has been implicated in almost all aspects of non-canonical Wnt signalling. In terms of cancer development, Wnt-5a has, until recently, lived in the shadow of its better-characterised relatives. This was largely because of its apparent inability to transform cells or signal through the canonical beta-catenin pathway that is so important in cancer, particularly colorectal cancer. Recent work in a wide range of human tumours has pointed to a critical role for Wnt-5a in malignant progression, but there is conflicting evidence whether Wnt-5a has a tumour-promoting or -suppressing role. Emerging evidence suggests that the functions of Wnt-5a can be drastically altered depending on the availability of key receptors. Hence, the presence or absence of these receptors may go some way to explain the conflicting role of Wnt-5a in different cancers.
Product Categories/Family for Wnt-5a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.9kDa
NCBI Official Full Name
protein Wnt-5a isoform 2
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 5A
NCBI Official Symbol
WNT5A
NCBI Official Synonym Symbols
hWNT5A
NCBI Protein Information
protein Wnt-5a; WNT-5A protein
UniProt Protein Name
Protein Wnt-5a
UniProt Gene Name
WNT5A
UniProt Entry Name
WNT5A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Wnt-5a wnt5a (Catalog #AAA79315) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human Wnt-5a reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Protein Sequence: MIIGAQPLCS QLAGLSQGQK KLCHLYQDHM QYIGEGAKTG IKECQYQFRH RRWNCSTVDN TSVFGRVMQI GSRETAFTYA VSAAGVVNAM SRACREGELS TCGCSRAARP KDLPRDWLWG GCGDNIDYGY RFAKEFVDAR ERERIHAKGS YESARILMNL HNNEAGRRTV YNLADVACKC HGVSGSCSLK TCWLQLADFR KVGDALKEKY DSAAAMRLNS RGKLVQVNSR FNSPTTQDLV YIDPSPDYCV RNESTGSLGT QGRLCNKTSE GMDGCELMCC GRGYDQFKTV QTERCHCKFH WCCYVKCKKC TEIVDQFVCK LEHHHHHH. It is sometimes possible for the material contained within the vial of "Wnt-5a, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.