Complement C3 Recombinant Protein | C3 recombinant protein

Recombinant Mouse Complement C3 (C3), partial

Cat. Num. AAA18546

• Gene Names: C3; ASP; Plp; HSE-MSF; AI255234
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Complement C3; Recombinant Mouse Complement C3 (C3); partial; HSE-MSF; C3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1321-1663aa; Partial
• Sequence: SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCP

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for C3 recombinant protein

C3 plays a central role in the activation of the complent system. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity. C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation. Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.

References

Nucleotide sequence of complementary DNA and derived amino acid sequence of murine complement protein C3.Fey G.H., Lundwall A., Wetsel R.A., Tack B.F., de Bruijn M.H.L., Domdey H.Philos. Trans. R. Soc. Lond., B, Biol. Sci. 306:333-344(1984) Structure of murine complement component C3. I. Nucleotide sequence of cloned complementary and genomic DNA coding for the beta chain.Lundwall A., Wetsel R.A., Domdey H., Tack B.F., Fey G.H.J. Biol. Chem. 259:13851-13856(1984) Isolation and analysis of genomic DNA clones encoding the third component of mouse complement.Wiebauer K., Domdey H., Diggelmann H., Fey G.Proc. Natl. Acad. Sci. U.S.A. 79:7077-7081(1982) Common evolutionary origin of alpha 2-macroglobulin and complement components C3 and C4.Sottrup-Jensen L., Stepanik T.M., Kristensen T., Lonblad P.B., Jones C.M., Wierzbicki D.M., Magnusson S., Domdey H., Wetsel R.A., Lundwall A., Tack B.F., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 82:9-13(1985) Structure and expression of the C3 gene.Fey G., Domdey H., Wiebauer K., Whitehead A.S., Odink K.Springer Semin. Immunopathol. 6:119-147(1983) A paracrine migration-stimulating factor for metastatic tumor cells secreted by mouse hepatic sinusoidal endothelial cells identification as complement component C3b.Hamada J., Cavanaugh P.G., Miki K., Nicolson G.L.Cancer Res. 53:4418-4423(1993) The specific production of the third component of complement by osteoblastic cells treated with 1 alpha,25-dihydroxyvitamin D3.Sato T., Hong M.H., Jin C.H., Ishimi Y., Udagawa N., Shinki T., Abe E., Suda T.FEBS Lett. 285:21-24(1991) Amino acid sequences of mouse complement C3 derived from nucleotide sequences of cloned cDNA.Fey G.H., Wiebauer K., Domdey H.Ann. N. Y. Acad. Sci. 421:307-312(1983) Structure of murine complement component C3. II. Nucleotide sequence of cloned complementary DNA coding for the alpha chain.Wetsel R.A., Lundwall A., Davidson F., Gibson T., Tack B.F., Fey G.H.J. Biol. Chem. 259:13857-13862(1984) Characterization of the mRNA and cloned cDNA specifying the third component of mouse complement.Domdey H., Wiebauer K., Kazmaier M., Mueller V., Odink K., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 79:7619-7623(1982) The structure of an alternate form of complement C3 that displays costimulatory growth factor activity for B lymphocytes.Cahen-Kramer Y., Martensson I.L., Melchers F.J. Exp. Med. 180:2079-2088(1994) Acylation-stimulating protein (ASP) deficiency induces obesity resistance and increased energy expenditure in ob/ob mice.Xia Z., Sniderman A.D., Cianflone K.J. Biol. Chem. 277:45874-45879(2002) Acylation-stimulating protein deficiency and altered adipose tissue in alternative complement pathway knockout mice.Paglialunga S., Fisette A., Yan Y., Deshaies Y., Brouillette J.F., Pekna M., Cianflone K.Am. J. Physiol. 294:E521-E529(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 126518317
• NCBI GeneID: 12266
• NCBI Accession #: NP_033908.2
• NCBI GenBank Nucleotide #: NM_009778.3
• UniProt Accession #: P01027; Q61370; Q80XP1
• Molecular Weight: 55.3 kDa
• NCBI Official Full Name: complement C3 preproprotein
• NCBI Official Synonym Full Names: complement component 3
• NCBI Official Symbol: C3
• NCBI Official Synonym Symbols: ASP; Plp; HSE-MSF; AI255234
• UniProt Protein Name: Complement C3
• UniProt Gene Name: C3
• UniProt Synonym Gene Names: C3bc; ASP
• UniProt Entry Name: CO3_MOUSE