SDS-PAGE
Beta-lactamase CTX-M-1 Recombinant Protein | bla recombinant protein
Recombinant Escherichia coli Beta-lactamase CTX-M-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-lactamase CTX-M-1; Recombinant Escherichia coli Beta-lactamase CTX-M-1; Beta-lactamase MEN-1Cefotaximase 1; bla recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-291aa; Full Length of Mature Protein
Sequence
QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for bla recombinant protein
Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
References
Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1)
and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases.Bauernfeind A., Stemplinger I., Jungwirth R., Casellas J.M.Antimicrob. Agents Chemother. 40:509-513(1996)
Close amino acid sequence relationship between the new plasmid-mediated extended-spectrum beta-lactamase MEN-1 and chromosomally encoded enzymes of Klebsiella oxytoca.Barthelemy M., Peduzzi J., Bernard H., Tancrede C., Labia R.Biochim. Biophys. Acta 1122:15-22(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.2 kDa
NCBI Official Full Name
MULTISPECIES: class A extended-spectrum beta-lactamase CTX-M-1
NCBI Official Symbol
D616_p79006
NCBI Protein Information
CTX-M-1
UniProt Protein Name
Beta-lactamase CTX-M-1
UniProt Gene Name
bla
UniProt Synonym Gene Names
men1
UniProt Entry Name
BLC1_ECOLX
Similar Products
Product Notes
The bla bla (Catalog #AAA18639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-291aa; Full Length of Mature Protein. The amino acid sequence is listed below: QTADVQQKLA ELERQSGGRL GVALINTADN SQILYRADER FAMCSTSKVM AVAAVLKKSE SEPNLLNQRV EIKKSDLVNY NPIAEKHVDG TMSLAELSAA ALQYSDNVAM NKLISHVGGP ASVTAFARQL GDETFRLDRT EPTLNTAIPG DPRDTTSPRA MAQTLRNLTL GKALGDSQRA QLVTWMKGNT TGAASIQAGL PASWVVGDKT GSGDYGTTND IAVIWPKDRA PLILVTYFTQ PQPKAESRRD VLASAAKIVT NGL . It is sometimes possible for the material contained within the vial of "Beta-lactamase CTX-M-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
