Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit LAS1L Polyclonal Antibody | anti-LAS1L antibody

LAS1L Antibody - middle region

Gene Names
LAS1L; WTS; Las1-like; dJ475B7.2
Reactivity
Cow, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LAS1L; Polyclonal Antibody; LAS1L Antibody - middle region; anti-LAS1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
Sequence Length
734
Applicable Applications for anti-LAS1L antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot) (WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: OVCAR-3Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: OVCAR-3Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: MCF7Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: MCF7Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: JurkatAntibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: JurkatAntibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: HT1080Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HT1080)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: HT1080Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HT1080)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: HelaAntibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: HelaAntibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: LAS1LSample Type: COLO205Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in COLO205)

WB (Western Blot) (Host: RabbitTarget Name: LAS1LSample Type: COLO205Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-LAS1L antibody
This is a rabbit polyclonal antibody against LAS1L. It was validated on Western Blot

Target Description: The function of LAS1L has not been determined.
Product Categories/Family for anti-LAS1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
ribosomal biogenesis protein LAS1L isoform 1
NCBI Official Synonym Full Names
LAS1 like, ribosome biogenesis factor
NCBI Official Symbol
LAS1L
NCBI Official Synonym Symbols
WTS; Las1-like; dJ475B7.2
NCBI Protein Information
ribosomal biogenesis protein LAS1L
UniProt Protein Name
Ribosomal biogenesis protein LAS1L
UniProt Gene Name
LAS1L
UniProt Synonym Gene Names
MSTP060
UniProt Entry Name
LAS1L_HUMAN

Similar Products

Product Notes

The LAS1L las1l (Catalog #AAA23435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAS1L Antibody - middle region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAS1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LAS1L las1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSFGSEAKAQ QQEEQGSVND VKEEEKEEKE VLPDQVEEEE ENDDQEEEEE. It is sometimes possible for the material contained within the vial of "LAS1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.