Actin-related protein 3 (ACTR3) Recombinant Protein | ACTR3 recombinant protein
Recombinant Human Actin-related protein 3 (ACTR3)
Gene Names
ACTR3; ARP3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Actin-related protein 3 (ACTR3); N/A; Recombinant Human Actin-related protein 3 (ACTR3); ACTR3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-418. Full Length of Mature Protein
Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ACTR3 recombinant protein
The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2
3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.
3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,371 Da
NCBI Official Full Name
actin-related protein 3 isoform 1
NCBI Official Synonym Full Names
ARP3 actin related protein 3 homolog
NCBI Official Symbol
ACTR3
NCBI Official Synonym Symbols
ARP3
NCBI Protein Information
actin-related protein 3
UniProt Protein Name
Actin-related protein 3
UniProt Gene Name
ACTR3
UniProt Synonym Gene Names
ARP3
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ACTR3 actr3 (Catalog #AAA113947) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-418. Full Length of Mature Protein. The amino acid sequence is listed below: AGRLPACVVD CGTGYTKLGY AGNTEPQFII PSCIAIKESA KVGDQAQRRV MKGVDDLDFF IGDEAIEKPT YATKWPIRHG IVEDWDLMER FMEQVIFKYL RAEPEDHYFL LTEPPLNTPE NREYTAEIMF ESFNVPGLYI AVQAVLALAA SWTSRQVGER TLTGTVIDSG DGVTHVIPVA EGYVIGSCIK HIPIAGRDIT YFIQQLLRDR EVGIPPEQSL ETAKAVKERY SYVCPDLVKE FNKYDTDGSK WIKQYTGINA ISKKEFSIDV GYERFLGPEI FFHPEFANPD FTQPISEVVD EVIQNCPIDV RRPLYKNIVL SGGSTMFRDF GRRLQRDLKR TVDARLKLSE ELSGGRLKPK PIDVQVITHH MQRYAVWFGG SMLASTPEFY QVCHTKKDYE EIGPSICRHN PVFGVMS. It is sometimes possible for the material contained within the vial of "Actin-related protein 3 (ACTR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.