AT-rich interactive domain-containing protein 1A (ARID1A) Recombinant Protein | ARID1A recombinant protein
Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial
Gene Names
ARID1A; ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
AT-rich interactive domain-containing protein 1A (ARID1A); N/A; Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial; BRG1-associated factor 250; BRG1-associated factor 250a; Osa homolog 1; SWI-like protein; SWI/SNF complex protein p270; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; ARID1A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1976-2231aa; partial
Sequence
SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Organism
Homo sapiens (Human)
Tag Information
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Production Note
Special Offer: The Baculovirus, E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ARID1A recombinant protein
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth
Product Categories/Family for ARID1A recombinant protein
References
"A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex." Nie Z., Xue Y., Yang D., Zhou S., Deroo B.J., Archer T.K., Wang W.Mol. Cell. Biol. 20:8879-8888 (2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.4 kDa
NCBI Official Full Name
AT-rich interactive domain-containing protein 1A isoform a
NCBI Official Synonym Full Names
AT-rich interaction domain 1A
NCBI Official Symbol
ARID1A
NCBI Official Synonym Symbols
ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1
NCBI Protein Information
AT-rich interactive domain-containing protein 1A
UniProt Protein Name
AT-rich interactive domain-containing protein 1A
UniProt Gene Name
ARID1A
UniProt Synonym Gene Names
BAF250; BAF250A; C1orf4; OSA1; SMARCF1; ARID domain-containing protein 1A; BAF250; BAF250A; hOSA1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ARID1A arid1a (Catalog #AAA235196) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1976-2231aa; partial with tag N-terminal 10xHis-tagged and C-terminal Myc-tagged. The amino acid sequence is listed below: SLAKRCVCVS NTIRSLSFVP GNDFEMSKHP GLLLILGKLI LLHHKHPERK QAPLTYEKEE EQDQGVSCNK VEWWWDCLEM LRENTLVTLA NISGQLDLSP YPESICLPVL DGLLHWAVCP SAEAQDPFST LGPNAVLSPQ RLVLETLSKL SIQDNNVDLI LATPPFSRLE KLYSTMVRFL SDRKNPVCRE MAVVLLANLA QGDSLAARAI AVQKGSIGNL LGFLEDSLAA TQFQQSQASL LHMQNPPFEP TSVDMM. It is sometimes possible for the material contained within the vial of "AT-rich interactive domain-containing protein 1A (ARID1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
