B-Raf Proto-Oncogene Recombinant Protein | BRAF recombinant protein
Recombinant Human B-Raf Proto-Oncogene
Gene Names
BRAF; NS7; BRAF1; RAFB1; B-RAF1
Purity
Greater than 80.0% as determined by SDS-PAGE.
Synonyms
B-Raf Proto-Oncogene; N/A; Recombinant Human B-Raf Proto-Oncogene; BRAF Human; B-Raf Proto-Oncogene Human Recombinant; Serine/Threonine Kinase; V-Raf Murine Sarcoma Viral Oncogene Homolog B1; V-Raf Murine Sarcoma Viral Oncogene Homolog B; Proto-Oncogene B-Raf; BRAF1; RAFB1; NS7; B-Raf Proto-Oncogene Serine/Threonine-Protein Kinase (P94); Murine Sarcoma Viral (V-Raf) Oncogene Homolog B1; Serine/Threonine-Protein Kinase B-Raf; 94 KDa B-Raf Protein; EC 2.7.11.1; B-RAF1; P94; Serine/threonine-protein kinase B-raf; Proto-oncogene B-Raf; p94; v-Raf murine sarcoma viral oncogene homolog B1; BRAF recombinant protein
Host
E. coli
Purity/Purification
Greater than 80.0% as determined by SDS-PAGE.
Form/Format
BRAF protein solution (0.25mg/ml) containing 20mM Tris-HCl (pH8.0) and 10% glycerol.
Sequence
MGSSHHHHHH SSGLVPRGSHMGSEF SEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Sequence Length
766
Physical Appearance
Sterile Filtered colorless solution.
Preparation and Storage
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Related Product Information for BRAF recombinant protein
BRAF Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 360 amino acids (432-766a.a) and having a molecular mass of 40.6kDa. BRAF is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Product Categories/Family for BRAF recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase B-raf
NCBI Official Synonym Full Names
B-Raf proto-oncogene, serine/threonine kinase
NCBI Official Symbol
BRAF
NCBI Official Synonym Symbols
NS7; BRAF1; RAFB1; B-RAF1
NCBI Protein Information
serine/threonine-protein kinase B-raf
UniProt Protein Name
Serine/threonine-protein kinase B-raf
UniProt Gene Name
BRAF
UniProt Synonym Gene Names
BRAF1; RAFB1
UniProt Entry Name
BRAF_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
B-RAF Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
B-RAF Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
B-RAF Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: ELISA, Immunohistochemistry, Western Blot
Product Notes
The BRAF braf (Catalog #AAA37981) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHH HHH SSGLVPRGSH MGSEF SEDRNRMKTL GRRDSSDDWE IPDGQITVGQ RIGSGSFGTV YKGKWHGDVA VKMLNVTAPT PQQLQAFKNE VGVLRKTRHV NILLFMGYST KPQLAIVTQW CEGSSLYHHL HIIETKFEMI KLIDIARQTA QGMDYLHAKS IIHRDLKSNN IFLHEDLTVK IGDFGLATVK SRWSGSHQFE QLSGSILWMA PEVIRMQDKN PYSFQSDVYA FGIVLYELMT GQLPYSNINN RDQIIFMVGR GYLSPDLSKV RSNCPKAMKR LMAECLKKKR DERPLFPQIL ASIELLARSL PKIHRSASEP SLNRAGFQTE DFSLYACASP KTPIQAGGYG AFPVH. It is sometimes possible for the material contained within the vial of "B-Raf Proto-Oncogene, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.