Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113498_SDS_PAGE15.jpg SDS-PAGE

CD81 antigen Recombinant Protein | Cd81 recombinant protein

Recombinant Mouse CD81 antigen (Cd81), partial

Average rating 0.0
No ratings yet
Gene Names
Cd81; Tapa1; Tapa-1; Tspan28
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD81 antigen; N/A; Recombinant Mouse CD81 antigen (Cd81), partial; 26 kDa cell surface protein TAPA-1; Target of the antiproliferative antibody 1; CD81; Cd81 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
116-201aa; partial;
Sequence
KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113498_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Cd81 recombinant protein
May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
References
Genomic organization and chromosomal localization of the TAPA-1 gene.Andria M.L., Hsieh C.L., Oren R., Francke U., Levy S.J. Immunol. 147:1030-1036(1991) Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse.Paulsen M., El-Maarri O., Engemann S., Stroedicke M., Franck O., Davies K., Reinhardt R., Reik W., Walter J.Hum. Mol. Genet. 9:1829-1841(2000) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Duff K., Parsons J. Lubec G., Kang S.U.Submitted (APR-2007) to UniProtKB PGRL is a major CD81-associated protein on lymphocytes and distinguishes a new family of cell surface proteins.Clark K.L., Zeng Z., Langford A.L., Bowen S.M., Todd S.C.J. Immunol. 167:5115-5121(2001) Reduced fertility of female mice lacking CD81.Rubinstein E., Ziyyat A., Prenant M., Wrobel E., Wolf J.-P., Levy S., Le Naour F., Boucheix C.Dev. Biol. 290:351-358(2006) Expression of the mouse fragilis gene products in immune cells and association with receptor signaling complexes.Smith R.A., Young J., Weis J.J., Weis J.H.Genes Immun. 7:113-121(2006) Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.4 kDa
NCBI Official Full Name
CD81 antigen
NCBI Official Synonym Full Names
CD81 antigen
NCBI Official Symbol
Cd81
NCBI Official Synonym Symbols
Tapa1; Tapa-1; Tspan28
NCBI Protein Information
CD81 antigen
UniProt Protein Name
CD81 antigen
UniProt Gene Name
Cd81
UniProt Synonym Gene Names
Tapa1
UniProt Entry Name
CD81_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Cd81 cd81 (Catalog #AAA113498) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 116-201aa; partial;. The amino acid sequence is listed below: KDQIAKDVKQ FYDQALQQAV MDDDANNAKA VVKTFHETLN CCGSNALTTL TTTILRNSLC PSGGNILTPL LQQDCHQKID ELFSGK. It is sometimes possible for the material contained within the vial of "CD81 antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.