SDS-PAGE
CD82 antigen Recombinant Protein | Cd82 recombinant protein
Recombinant Mouse CD82 antigen
Gene Names
Cd82; C33; IA4; Kai1; Tspan27; AA682076; AL023070
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD82 antigen; N/A; Recombinant Mouse CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1 homolog; CD82; Cd82 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
111-227aa; Extracellular Domain
Sequence
DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF
Sequence Length
266
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Cd82 recombinant protein
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
References
Mouse homologue of C33 antigen (CD82) , a member of the transmembrane 4 superfamily complementary DNA, genomic structure, and expression.Nagira M., Imai T., Ishikawa I., Uwabe K.I., Yoshie O.Cell. Immunol. 157:144-157(1994) The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.5 kDa
NCBI Official Full Name
CD82 antigen
NCBI Official Synonym Full Names
CD82 antigen
NCBI Official Symbol
Cd82
NCBI Official Synonym Symbols
C33; IA4; Kai1; Tspan27; AA682076; AL023070
NCBI Protein Information
CD82 antigen
UniProt Protein Name
CD82 antigen
UniProt Gene Name
Cd82
UniProt Synonym Gene Names
Kai1
UniProt Entry Name
CD82_MOUSE
Similar Products
Product Notes
The Cd82 cd82 (Catalog #AAA113277) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 111-227aa; Extracellular Domain. The amino acid sequence is listed below: DKLKKEMGNT VMDIIRNYTA NATSSREEAW DYVQAQVKCC GWVSHYNWTE NEELMGFTKT TYPCSCEKIK EEDNQLIVKK GFCEADNSTV SENNPEDWPV NTEGCMEKAQ AWLQENF. It is sometimes possible for the material contained within the vial of "CD82 antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.