COL18A1 recombinant protein
Recombinant Human COL18A1 Protein
Gene Names
COL18A1; KS; KNO; KNO1
Applications
ELISA, Western Blot
Purity
Purity: > 90 % as determined by SDS-PAGE.Purification: Affinity purified using AC.
Synonyms
COL18A1; N/A; Recombinant Human COL18A1 Protein; COL18-A1; COL18; KNO; Endostatin; Collagen Type XVIII.; COL18A1 recombinant protein
Host
E Coli
Purity/Purification
Purity: > 90 % as determined by SDS-PAGE.
Purification: Affinity purified using AC.
Purification: Affinity purified using AC.
Form/Format
Lyophilized powder; Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Sequence Positions
1578-1754
Sequence
QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Sequence Length
1754
Applicable Applications for COL18A1 recombinant protein
ELISA, WB (Western Blot)
Source
Human
Protein Residue
with N-terminal GST-tagged.
Usage
COL18A1 Protein - We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Storage: Store it under sterile conditions at -20°C/-80°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C/-80°C.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C/-80°C.
Related Product Information for COL18A1 recombinant protein
Collagen, type XVIII, alpha 1, also known as COL18A1, alpha chain of type XVIII collagen. This collagen is one of the multiplexins, extracellular matrix proteins that contain multiple triple-helix domains (collagenous domains) interrupted by non-collagenous domains. The proteolytically produced C-terminal fragment of type XVIII collagen is endostatin, a potent antiangiogenic protein. Mutations in this gene are associated with Knobloch syndrome. The main features of this syndrome involve retinal abnormalities so type XVIII collagen may play an important role in retinal structure and in neural tube closure. Two transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 46.3kDa
Observed: 46kDa
Observed: 46kDa
NCBI Official Full Name
collagen alpha-1(XVIII) chain isoform 1 preproprotein
NCBI Official Synonym Full Names
collagen type XVIII alpha 1 chain
NCBI Official Symbol
COL18A1
NCBI Official Synonym Symbols
KS; KNO; KNO1
NCBI Protein Information
collagen alpha-1(XVIII) chain
UniProt Protein Name
Collagen alpha-1(XVIII) chain
UniProt Gene Name
COL18A1
UniProt Entry Name
COIA1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The COL18A1 col18a1 (Catalog #AAA55959) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1578-1754. AAA Biotech's COL18A1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the COL18A1 col18a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPVLHLVALN SPLSGGMRGI RGADFQCFQQ ARAVGLAGTF RAFLSSRLQD LYSIVRRADR AAVPIVNLKD ELLFPSWEAL FSGSEGPLKP GARIFSFDGK DVLRHPTWPQ KSVWHGSDPN GRRLTESYCE TWRTEAPSAT GQASSLLGGR LLGQSAASCH HAYIVLCIEN SFMTASK. It is sometimes possible for the material contained within the vial of "COL18A1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
