Collagen alpha-3 (IV) chain (Col4a3) Recombinant Protein | Col4a3 recombinant protein
Recombinant Mouse Collagen alpha-3 (IV) chain (Col4a3) , partial
Gene Names
Col4a3; [a]3(IV); alpha3(IV)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-3 (IV) chain (Col4a3); N/A; Recombinant Mouse Collagen alpha-3 (IV) chain (Col4a3) , partial; Col4a3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1424-1669aa; Partial
Sequence
PGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Col4a3 recombinant protein
Type IV collagen, the major structural component of basement membranes, is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. This gene encodes alpha 3. In the Goodpasture syndrome, autoantibodies bind to the collagen molecules in the basement membranes of alveoli and glomeruli. The epitopes that elicit these autoantibodies are localized largely to the non-collagenous C-terminal domain of the protein. A specific kinase phosphorylates amino acids in this same C-terminal region and the expression of this kinase is upregulated during pathogenesis. There are multiple alternate transcripts that appear to be unique to this human alpha 3 gene and alternate splicing is restricted to the six exons that encode this C-terminal domain. This gene is also linked to an autosomal recessive form of Alport syndrome. The mutations contributing to this syndrome are also located within the exons that encode this C-terminal region. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. Some exons of this gene are interspersed with exons of an uncharacterized gene which is on the opposite strand.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
161,726 Da
NCBI Official Full Name
collagen alpha-3(IV) chain
NCBI Official Synonym Full Names
collagen, type IV, alpha 3
NCBI Official Symbol
Col4a3
NCBI Official Synonym Symbols
[a]3(IV); alpha3(IV)
NCBI Protein Information
collagen alpha-3(IV) chain
UniProt Protein Name
Collagen alpha-3(IV) chain
UniProt Gene Name
Col4a3
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Col4a3 col4a3 (Catalog #AAA117761) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1424-1669aa; Partial. The amino acid sequence is listed below: PGLKGNPGDR GTPATGTRMR GFIFTRHSQT TAIPSCPEGT QPLYSGFSLL FVQGNKRAHG QDLGTLGSCL QRFTTMPFLF CNINNVCNFA SRNDYSYWLS TPALMPMDMA PISGRALEPY ISRCTVCEGP AMAIAVHSQT TAIPPCPQDW VSLWKGFSFI MFTSAGSEGA GQALASPGSC LEEFRASPFI ECHGRGTCNY YSNSYSFWLA SLNPERMFRK PIPSTVKAGD LEKIISRCQV CMKKRH. It is sometimes possible for the material contained within the vial of "Collagen alpha-3 (IV) chain (Col4a3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.