CCL19 active protein
Recombinant CCL19 (MIP-3β)
Gene Names
CCL19; ELC; CKb11; MIP3B; MIP-3b; SCYA19
Purity
>97% by SDS-PAGE
Synonyms
CCL19; N/A; Recombinant CCL19 (MIP-3β); Recombinant Human CCL19; CCL19 active protein
Host
E. coli
Purity/Purification
>97% by SDS-PAGE
Form/Format
Sterile Filtered White Lyophilized Powder
Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Host Note
Recombinant human CCL19 produced in E. coli (accession no. Q99731).
Preservative
None
Appearance
White powder
Activity
EC50 = 30nM determined by calcium flux with recombinant human CCR7.
Endotoxin Level
<0.01 EU per 1ug of protein by LAL method.
Carrier Protein
None
Reconstitution
Recommended at 100ug/ml in sterile distilled water.
Preparation and Storage
12 months from date of receipt, -20°C to -70°C, as supplied.
1 month, 2°C to 8°C, under sterile conditions after reconstitution.
3 months, -20°C to -70°C, under sterile conditions after reconstitution.
1 month, 2°C to 8°C, under sterile conditions after reconstitution.
3 months, -20°C to -70°C, under sterile conditions after reconstitution.
Related Product Information for CCL19 active protein
CCL19 (also known as Macrophage Inflammatory Protein-3β, MIP-3β, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
8.8kDa by Mass Spec.
NCBI Official Full Name
C-C motif chemokine 19
NCBI Official Synonym Full Names
C-C motif chemokine ligand 19
NCBI Official Symbol
CCL19
NCBI Official Synonym Symbols
ELC; CKb11; MIP3B; MIP-3b; SCYA19
NCBI Protein Information
C-C motif chemokine 19
UniProt Protein Name
C-C motif chemokine 19
UniProt Gene Name
CCL19
UniProt Synonym Gene Names
ELC; MIP3B; SCYA19; EBI1 ligand chemokine; ELC; MIP-3-beta
UniProt Entry Name
CCL19_HUMAN
Similar Products
Product Notes
The CCL19 ccl19 (Catalog #AAA47963) is an Active Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GTNDAEDCCL SVTQKPIPGY IVRNFHYLLI KDGCRVPAVV FTTLRGRQLC APPDQPWVER IIQRLQRTSA KMKRRSS. It is sometimes possible for the material contained within the vial of "CCL19, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.