Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA269808_SDS_PAGE13.png SDS-PAGE (SDS-PAGE of VEGF-121 (#AAA269808).)

VEGF-121 protein

VEGF-121 (His tag)

Average rating 0.0
No ratings yet
Synonyms
VEGF-121; N/A; VEGF-121 (His tag); Vascular Endothelial Growth Factor A; VEGFA; VEGF-A; Vascular Permeability Factor; VPF; VEGF; VEGF121; VEGF-121 protein
Ordering
Host
E coli
Form/Format
Purified protein solution after extensive dialysis against PBS, pH 7.5
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
Accession #: 
P15692-9
Species
Human
Tag
His
Expression System
Vascular endothelial growth factor (VEGF), produced in E coli is a single non-glycosylated polypeptide chain containing 121 amino acids. A fully biologically active molecule has a molecular mass of 14 kDa. The apparent molecular mass of the protein is approximately 18kD analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
Preparation and Storage
Upon receiving, this product remains stable for up to 6 months at lower than -70 degree C. Upon reconstitution, the product should be stable for up to 1 week at 4 degree C or up to 3 months at -20 degree C. For long term storage it is recommended that a carrier protein (example 0.1% BSA) be added. Avoid repeated freeze-thaw cycles.

SDS-PAGE

(SDS-PAGE of VEGF-121 (#AAA269808).)

product-image-AAA269808_SDS_PAGE13.png SDS-PAGE (SDS-PAGE of VEGF-121 (#AAA269808).)

Application Data

product-image-AAA269808_AD15.png Application Data
Related Product Information for VEGF-121 protein
VEGF-A121 is one of five isoforms (121, 145, 165, 189, and 206) of VEGF protein, a cytokine belonging to the Platelet Differentiation Growth Factor (PDGF) family, and existing as a disulfide-linked homodimeric glycoprotein. In contrast to the longer isoforms, VEGF-A121 is more freely diffusible, and cannot bind to heparin. In vivo, VEGF is expressed predominantly in lung, heart, kidney, and adrenal glands, and the expression of VEGF is up-regulated by a number of growth factors, including PDGF, Fibroblast Growth Factor (FGF), Epidermal Growth Factor (EGF), and Tumor Necrosis Factor (TNF). VEGF signals via binding to two tyrosine kinase receptors: the Fms-like tyrosine kinase 1 (Flt-1) and the kinase domain receptor (KDR). VEGF is a specific mitogen and survival factor, contributing to abnormal angiogenesis and cancer development
Product Categories/Family for VEGF-121 protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VEGF-121 (Catalog #AAA269808) is a Protein produced from E coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQENCDKPR R Acces sion #:  P1 5692-9. It is sometimes possible for the material contained within the vial of "VEGF-121, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.