DNA repair protein complementing XP-G cells Recombinant Protein | ERCC5 recombinant protein
Recombinant Human DNA repair protein complementing XP-G cells
Gene Names
ERCC5; XPG; UVDR; XPGC; COFS3; ERCM2; ERCC5-201
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA repair protein complementing XP-G cells; N/A; Recombinant Human DNA repair protein complementing XP-G cells; DNA excision repair protein ERCC-5; Xeroderma pigmentosum group G-complementing protein; ERCC5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
947-1186aa; Partial
Sequence
SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Sequence Length
1186
Species
Homo sapiens
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ERCC5 recombinant protein
Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.
Product Categories/Family for ERCC5 recombinant protein
References
"Complementation of the DNA repair defect in Xeroderma pigmentosum group G cells by a human cDNA related to yeast RAD2." Scherly D., Nouspikel T., Corlet J., Ucla C., Bairoch A., Clarkson S.G. Nature 363:182-185(1993)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30.8 kDa
NCBI Official Full Name
DNA repair protein complementing XP-G cells
NCBI Official Synonym Full Names
excision repair cross-complementation group 5
NCBI Official Symbol
ERCC5
NCBI Official Synonym Symbols
XPG; UVDR; XPGC; COFS3; ERCM2; ERCC5-201
NCBI Protein Information
DNA repair protein complementing XP-G cells
UniProt Protein Name
DNA repair protein complementing XP-G cells
UniProt Gene Name
ERCC5
UniProt Synonym Gene Names
ERCM2; XPG; XPGC
UniProt Entry Name
ERCC5_HUMAN
Similar Products
Product Notes
The ERCC5 ercc5 (Catalog #AAA113119) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 947-1186aa; Partial. The amino acid sequence is listed below: SFLWGKPDLD KIREFCQRYF GWNRTKTDES LFPVLKQLDA QQTQLRIDSF FRLAQQEKED AKRIKSQRLN RAVTCMLRKE KEAAASEIEA VSVAMEKEFE LLDKAKGKTQ KRGITNTLEE SSSLKRKRLS DSKGKNTCGG FLGETCLSES SDGSSSEDAE SSSLMNVQRR TAAKEPKTSA SDSQNSVKEA PVKNGGATTS SSSDSDDDGG KEKMVLVTAR SVFGKKRRKL RRARGRKRKT. It is sometimes possible for the material contained within the vial of "DNA repair protein complementing XP-G cells, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
