Hepatocyte nuclear factor 3-alpha (FOXA1) Recombinant Protein | FOXA1 recombinant protein
Recombinant Human Hepatocyte nuclear factor 3-alpha (FOXA1)
Gene Names
FOXA1; HNF3A; TCF3A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hepatocyte nuclear factor 3-alpha (FOXA1); N/A; Recombinant Human Hepatocyte nuclear factor 3-alpha (FOXA1); FOXA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-472, Full length protein
Sequence
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Sequence Length
472
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FOXA1 recombinant protein
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,468 Da
NCBI Official Full Name
hepatocyte nuclear factor 3-alpha
NCBI Official Synonym Full Names
forkhead box A1
NCBI Official Symbol
FOXA1
NCBI Official Synonym Symbols
HNF3A; TCF3A
NCBI Protein Information
hepatocyte nuclear factor 3-alpha
UniProt Protein Name
Hepatocyte nuclear factor 3-alpha
UniProt Gene Name
FOXA1
UniProt Synonym Gene Names
HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
Similar Products
Product Notes
The FOXA1 foxa1 (Catalog #AAA113335) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-472, Full length protein. The amino acid sequence is listed below: MLGTVKMEGH ETSDWNSYYA DTQEAYSSVP VSNMNSGLGS MNSMNTYMTM NTMTTSGNMT PASFNMSYAN PGLGAGLSPG AVAGMPGGSA GAMNSMTAAG VTAMGTALSP SGMGAMGAQQ AASMNGLGPY AAAMNPCMSP MAYAPSNLGR SRAGGGGDAK TFKRSYPHAK PPYSYISLIT MAIQQAPSKM LTLSEIYQWI MDLFPYYRQN QQRWQNSIRH SLSFNDCFVK VARSPDKPGK GSYWTLHPDS GNMFENGCYL RRQKRFKCEK QPGAGGGGGS GSGGSGAKGG PESRKDPSGA SNPSADSPLH RGVHGKTGQL EGAPAPGPAA SPQTLDHSGA TATGGASELK TPASSTAPPI SSGPGALASV PASHPAHGLA PHESQLHLKG DPHYSFNHPF SINNLMSSSE QQHKLDFKAY EQALQYSPYG STLPASLPLG SASVTTRSPI EPSALEPAYY QGVYSRPVLN TS. It is sometimes possible for the material contained within the vial of "Hepatocyte nuclear factor 3-alpha (FOXA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.