Interferon regulatory factor 5 (Irf5) Recombinant Protein | Irf5 recombinant protein
Recombinant Mouse Interferon regulatory factor 5 (Irf5)
Gene Names
Irf5; mirf5; AW491843
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon regulatory factor 5 (Irf5); N/A; Recombinant Mouse Interferon regulatory factor 5 (Irf5); Irf5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-497. Full Length
Sequence
MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Irf5 recombinant protein
Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling.
References
Generation of mutant mice deficient in IRF5.Grossman A., Kondo S., Antonio L., Mak T.W. Functional regulation of MyD88-activated interferon regulatory factor 5 by K63-linked polyubiquitination.Balkhi M.Y., Fitzgerald K.A., Pitha P.M.Mol. Cell. Biol. 28:7296-7308(2008)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72 kDa
NCBI Official Full Name
interferon regulatory factor 5 isoform 1
NCBI Official Synonym Full Names
interferon regulatory factor 5
NCBI Official Symbol
Irf5
NCBI Official Synonym Symbols
mirf5; AW491843
NCBI Protein Information
interferon regulatory factor 5
UniProt Protein Name
Interferon regulatory factor 5
UniProt Gene Name
Irf5
UniProt Synonym Gene Names
IRF-5
UniProt Entry Name
IRF5_MOUSE
Similar Products
Product Notes
The Irf5 irf5 (Catalog #AAA113244) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497. Full Length. The amino acid sequence is listed below: MNHSAPGIPP PPRRVRLKPW LVAQVNSCQY PGLQWVNGEK KLFYIPWRHA TRHGPSQDGD NTIFKAWAKE TGKYTEGVDE ADPAKWKANL RCALNKSRDF QLFYDGPRDM PPQPYKIYEV CSNGPAPTES QPTDDYVLGE EEEEEEEELQ RMLPGLSITE PALPGPPNAP YSLPKEDTKW PPALQPPVGL GPPVPDPNLL APPSGNPAGF RQLLPEVLEP GPLASSQPPT EPLLPDLLIS PHMLPLTDLE IKFQYRGRAP RTLTISNPQG CRLFYSQLEA TQEQVELFGP VTLEQVRFPS PEDIPSDKQR FYTNQLLDVL DRGLILQLQG QDLYAIRLCQ CKVFWSGPCA LAHGSCPNPI QREVKTKLFS LEQFLNELIL FQKGQTNTPP PFEIFFCFGE EWPDVKPREK KLITVQVVPV AARLLLEMFS GELSWSADSI RLQISNPDLK DHMVEQFKEL HHLWQSQQQL QPMVQAPPVA GLDASQGPWP MHPVGMQ. It is sometimes possible for the material contained within the vial of "Interferon regulatory factor 5 (Irf5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
