Lymphotoxin-alpha (Lta) Recombinant Protein | Lta recombinant protein
Recombinant Mouse Lymphotoxin-alpha (Lta)
Gene Names
Lta; LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; Tnlg1e; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphotoxin-alpha (Lta); N/A; Recombinant Mouse Lymphotoxin-alpha (Lta); Lta recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-202aa; Full Length of Mature Protein
Sequence
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lta recombinant protein
Cytokine that in its homotrimeric form binds to TNFRSF1A
TNFR1, TNFRSF1B
TNFBR and TNFRSF14
HVEM. In its heterotrimeric form with LTB binds to TNFRSF3
LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
TNFR1, TNFRSF1B
TNFBR and TNFRSF14
HVEM. In its heterotrimeric form with LTB binds to TNFRSF3
LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Product Categories/Family for Lta recombinant protein
References
"The genes for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) are tandemly arranged on chromosome 17 of the mouse." Nedospasov S.A., Hirt B., Shakhov A.N., Dobrynin V.N., Kawashima E., Accolla R.S., Jongeneel C.V. Nucleic Acids Res. 14:7713-7725(1986)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.6 kDa
NCBI Official Full Name
lymphotoxin-alpha
NCBI Official Synonym Full Names
lymphotoxin A
NCBI Official Symbol
Lta
NCBI Official Synonym Symbols
LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; Tnlg1e; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta
NCBI Protein Information
lymphotoxin-alpha
UniProt Protein Name
Lymphotoxin-alpha
UniProt Gene Name
Lta
UniProt Synonym Gene Names
Tnfb; Tnfsf1; LT-alpha
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Lta lta (Catalog #AAA113125) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-202aa; Full Length of Mature Protein. The amino acid sequence is listed below: LSGVRFSAAR TAHPLPQKHL THGILKPAAH LVGYPSKQNS LLWRASTDRA FLRHGFSLSN NSLLIPTSGL YFVYSQVVFS GESCSPRAIP TPIYLAHEVQ LFSSQYPFHV PLLSAQKSVY PGLQGPWVRS MYQGAVFLLS KGDQLSTHTD GISHLHFSPS SVFFGAFAL. It is sometimes possible for the material contained within the vial of "Lymphotoxin-alpha (Lta), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
