CD276 antigen (CD276) Active Protein | CD276 active protein

Recombinant Human CD276 antigen (CD276), partial (Active)

Cat. Num. AAA279383

• Gene Names: CD276; B7H3; B7-H3; B7RP-2; 4Ig-B7-H3
• Purity: Greater than 95% as determined by SDS-PAGE.
• Synonyms: CD276 antigen (CD276); N/A; Recombinant Human CD276 antigen (CD276), partial (Active); 4Ig-B7-H3; B7 homolog 3 (B7-H3); Costimulatory molecule; CD276; CD276 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater than 95% as determined by SDS-PAGE.
• Form/Format: Lyophilized powder; Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
• Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
• Sequence Length: 29-245aa; Partial of Isoform 2

• Species: Homo sapiens (Human)
• Tag: C-terminal 10xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2ug/mL can bind Anti-CD276 recombinant antibody . The EC50 is 47.12-54.16ng/mL.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Related Product Information for CD276 active protein

May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.

Product Categories/Family for CD276 active protein

Cancer

References

The immunomodulatory proteins B7-DC, B7-H2, and B7-H3 are differentially expressed across gestation in the human placenta. Petroff M.G., Kharatyan E., Torry D.S., Holets L.Am. J. Pathol. 167:465-473 (2005)

NCBI and Uniprot Product Information

• NCBI GI #: 52694705
• NCBI GeneID: 80381
• UniProt Accession #: Q5ZPR3; Q6P5Y4; Q6UXI2; Q8NBI8; Q8NC34; Q8NCB6; Q9BXR1
• Molecular Weight: 57,235 Da
• NCBI Official Full Name: B7-H3 protein
• NCBI Official Synonym Full Names: CD276 molecule
• NCBI Official Symbol: CD276
• NCBI Official Synonym Symbols: B7H3; B7-H3; B7RP-2; 4Ig-B7-H3
• NCBI Protein Information: CD276 antigen; B7 homolog 3; costimulatory molecule
• UniProt Protein Name: CD276 antigen
• UniProt Gene Name: CD276
• UniProt Synonym Gene Names: B7H3; B7-H3
• UniProt Entry Name: CD276_HUMAN