SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Cytokine receptor common subunit gamma (IL2RG) Active Protein | IL2RG active protein
Recombinant Human Cytokine receptor common subunit gamma (IL2RG), partial (Active)
Gene Names
IL2RG; P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Cytokine receptor common subunit gamma (IL2RG); N/A; Recombinant Human Cytokine receptor common subunit gamma (IL2RG), partial (Active); Interleukin-2 receptor subunit gamma (IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG); gammaC; p64; CD132; IL2RG active protein
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder; Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4.
Sequence
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Sequence Length
23-254aa; Partial
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL2RG at 2ug/mL can bind Anti-IL2RG recombinant antibody . The EC50 is 12.19-13.63ng/mL.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Activity
Activity
Related Product Information for IL2RG active protein
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Product Categories/Family for IL2RG active protein
References
The DNA sequence of the human X chromosome. Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bentley D.R.Nature 434:325-337 (2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
369
NCBI Official Full Name
Cytokine receptor common subunit gamma
NCBI Official Synonym Full Names
interleukin 2 receptor, gamma
NCBI Official Symbol
IL2RG
NCBI Official Synonym Symbols
P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1
NCBI Protein Information
cytokine receptor common subunit gamma; gammaC; CD132 antigen; IL-2R subunit gamma; IL-2 receptor subunit gamma; common cytokine receptor gamma chain
UniProt Protein Name
Cytokine receptor common subunit gamma
UniProt Gene Name
IL2RG
UniProt Synonym Gene Names
IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG
UniProt Entry Name
IL2RG_HUMAN
Similar Products
Product Notes
The IL2RG il2rg (Catalog #AAA279362) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LNTTILTPNG NEDTTADFFL TTMPTDSLSV STLPLPEVQC FVFNVEYMNC TWNSSSEPQP TNLTLHYWYK NSDNDKVQKC SHYLFSEEIT SGCQLQKKEI HLYQTFVVQL QDPREPRRQA TQMLKLQNLV IPWAPENLTL HKLSESQLEL NWNNRFLNHC LEHLVQYRTD WDHSWTEQSV DYRHKFSLPS VDGQKRYTFR VRSRFNPLCG SAQHWSEWSH PIHWGSNTSK EN. It is sometimes possible for the material contained within the vial of "Cytokine receptor common subunit gamma (IL2RG), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.