Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA278901_BIOACTIVITY13.jpg Bioactivity

HLA class II histocompatibility antigen gamma chain (CD74) Active Protein | CD74 active protein

Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial (Active)

Gene Names
CD74; II; DHLAG; HLADG; Ia-GAMMA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
HLA class II histocompatibility antigen gamma chain (CD74); N/A; Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial (Active); (HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74); CD74 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
73-232aa, Partial of Isoform 2
Sequence
QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Species
Homo sapiens (Human)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Relevance
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.[Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.[Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2. Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2ug/mL can bind Anti-CD74 recombinant antibody , the EC50 is 1.317-1.646ng/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

product-image-AAA278901_BIOACTIVITY13.jpg Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA278901_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Product Categories/Family for CD74 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
972
UniProt Accession #
Molecular Weight
296
NCBI Official Full Name
HLA class II histocompatibility antigen gamma chain
NCBI Official Synonym Full Names
CD74 molecule, major histocompatibility complex, class II invariant chain
NCBI Official Symbol
CD74
NCBI Official Synonym Symbols
II; DHLAG; HLADG; Ia-GAMMA
NCBI Protein Information
HLA class II histocompatibility antigen gamma chain; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; gamma chain of class II antigens; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histo
UniProt Protein Name
HLA class II histocompatibility antigen gamma chain
UniProt Gene Name
CD74
UniProt Synonym Gene Names
DHLAG; Ii
UniProt Entry Name
HG2A_HUMAN

Similar Products

Product Notes

The CD74 cd74 (Catalog #AAA278901) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 73-232aa, Partial of Isoform 2. The amino acid sequence is listed below: QQQGRLDKLT VTSQNLQLEN LRMKLPKPPK PVSKMRMATP LLMQALPMGA LPQGPMQNAT KYGNMTEDHV MHLLQNADPL KVYPPLKGSF PENLRHLKNT METIDWKVFE SWMHHWLLFE MSRHSLEQKP TDAPPKESLE LEDPSSGLGV TKQDLGPVPM. It is sometimes possible for the material contained within the vial of "HLA class II histocompatibility antigen gamma chain (CD74), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.