Mitogen-activated protein kinase 14 (Mapk14) Recombinant Protein | Mapk14 recombinant protein
Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14)
Gene Names
Mapk14; p38; Crk1; Mxi2; p38a; CSBP2; Csbp1; PRKM14; PRKM15; p38MAPK; p38alpha; p38-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitogen-activated protein kinase 14 (Mapk14); N/A; Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14); Mapk14 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-360aa; Full Length of Mature Protein
Sequence
SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Mapk14 recombinant protein
This protein is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1
TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,327 Da
NCBI Official Full Name
mitogen-activated protein kinase 14 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase 14
NCBI Official Symbol
Mapk14
NCBI Official Synonym Symbols
p38; Crk1; Mxi2; p38a; CSBP2; Csbp1; PRKM14; PRKM15; p38MAPK; p38alpha; p38-alpha
NCBI Protein Information
mitogen-activated protein kinase 14
UniProt Protein Name
Mitogen-activated protein kinase 14
UniProt Gene Name
Mapk14
UniProt Synonym Gene Names
Crk1; Csbp1; Csbp2; MAP kinase 14; MAPK 14; MAP kinase p38 alpha
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Mapk14 mapk14 (Catalog #AAA113342) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-360aa; Full Length of Mature Protein. The amino acid sequence is listed below: SQERPTFYRQ ELNKTIWEVP ERYQNLSPVG SGAYGSVCAA FDTKTGHRVA VKKLSRPFQS IIHAKRTYRE LRLLKHMKHE NVIGLLDVFT PARSLEEFND VYLVTHLMGA DLNNIVKCQK LTDDHVQFLI YQILRGLKYI HSADIIHRDL KPSNLAVNED CELKILDFGL ARHTDDEMTG YVATRWYRAP EIMLNWMHYN QTVDIWSVGC IMAELLTGRT LFPGTDHIDQ LKLILRLVGT PGAELLKKIS SESARNYIQS LAQMPKMNFA NVFIGANPLA VDLLEKMLVL DSDKRITAAQ ALAHAYFAQY HDPDDEPVAD PYDQSFESRD LLIDEWKSLT YDEVISFVPP PLDQEEMES. It is sometimes possible for the material contained within the vial of "Mitogen-activated protein kinase 14 (Mapk14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.