Tau (K18) Delta K280 Mutant Recombinant Protein | Tau(K18) recombinant protein

Human Recombinant Tau (K18) Delta K280 Mutant Protein Pre-formed Fibrils

Cat. Num. AAA254097

• Gene Names: MAPT; TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; FTDP-17
• Applications: SDS-Page, Western Blot
• Purity: >95%; Ion-exchange Purified
• Synonyms: Tau (K18) Delta K280 Mutant; N/A; Human Recombinant Tau (K18) Delta K280 Mutant Protein Pre-formed Fibrils; Tau (K18) Delta K280 Mutant Pre-formed Fibrils; Tau PFFs; Tau PFF; Tau protein Pre-formed Fibrils; Tau aggregates; microtubule-associated protein Tau; MAPT; MAP; microtubule-associated protein; Paired Helical Filament-Tau; Phf-Tau; Neurofibrillary Tangle Protein; G Protein Beta1/Gamma2 Subunit-Interacting Factor 1; Isoform 4; tubulin-associated unit; MAPT DeltaK280; deltaK280 Tau; K18 delta K280 Tau; truncated deltaK280 Tau; Tau(K18) recombinant protein

• Host: E coli
• Purity/Purification: >95%; Ion-exchange Purified
• Form/Format: PBS pH 7.4
• Concentration: Lot/batch specific. See included datasheet. (varies by lot)
• Sequence: MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
• Sequence Length: Partial

• Applicable Applications for Tau(K18) recombinant protein: Invitro Assay, SDS-PAGE, WB (Western Blot)
• Species: Human
• Conjugation: No Tag
• Research Area: Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Cytoskeleton, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Tangles & Tau
• Cellular Localization: Cytoplasm, Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cell membrane, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytoskeleton, Cytosol, Dendrite, Growth cone, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Peripheral membrane protein, Plasma Membrane, Tubulin Complex
• Certificate of Analysis: Certified >95% pure using SDS-PAGE analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
• Preparation and Storage: Store at -80 degree C

Application Data

(ThioflavinTisafluorescentdyethatbindstobetasheet-richstructures,suchasthoseintaufibrils.Uponbinding,theemissionspectrumofthedyeexperiencesared-shiftandincreasedfluorescenceintensity.ThioflavinTemissioncurvesshowincreasedfluorescence(correlatedtotauaggregation)overtimewhentaumonomers arecombinedwithtaufibrils(AAA254097).)

Application Data

(TEMofHumanK18K280DeletionTauPre-formedFibrils(PFFs)(AAA254097))

Related Product Information for Tau(K18) recombinant protein

Alzheimer's Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The deltaK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).

Product Categories/Family for Tau(K18) recombinant protein

Proteins

References

1. www.alz.org/alzheimers-dementia/facts-figures2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146-148 (1907)3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497.4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174.5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.

NCBI and Uniprot Product Information

• NCBI GI #: 294862258
• NCBI GeneID: 4137
• NCBI Accession #: NP_001116538.2
• NCBI GenBank Nucleotide #: NM_001123066.3
• UniProt Accession #: P10636; P18518; Q14799; Q15549; Q15550; Q15551; Q1RMF6; Q53YB1; Q5CZI7; Q5XWF0; Q6QT54; Q9UDJ3
• Molecular Weight: 78,928 Da
• NCBI Official Full Name: microtubule-associated protein tau isoform 6
• NCBI Official Synonym Full Names: microtubule-associated protein tau
• NCBI Official Symbol: MAPT
• NCBI Official Synonym Symbols: TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; FTDP-17
• NCBI Protein Information: microtubule-associated protein tau; PHF-tau; paired helical filament-tau; neurofibrillary tangle protein; microtubule-associated protein tau, isoform 4; G protein beta1/gamma2 subunit-interacting factor 1
• UniProt Protein Name: Microtubule-associated protein tau
• UniProt Gene Name: MAPT
• UniProt Synonym Gene Names: MAPTL; MTBT1; TAU; PHF-tau
• UniProt Entry Name: TAU_HUMAN