Methyl-CpG-binding domain protein 2 (MBD2) Recombinant Protein | MBD2 recombinant protein
Recombinant Human Methyl-CpG-binding domain protein 2 (MBD2)
Gene Names
MBD2; DMTase; NY-CO-41
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methyl-CpG-binding domain protein 2 (MBD2); N/A; Recombinant Human Methyl-CpG-binding domain protein 2 (MBD2); MBD2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
145-411aa; Partial
Sequence
ESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MBD2 recombinant protein
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. This protein may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,745 Da
NCBI Official Full Name
methyl-CpG-binding domain protein 2 isoform 1
NCBI Official Synonym Full Names
methyl-CpG binding domain protein 2
NCBI Official Symbol
MBD2
NCBI Official Synonym Symbols
DMTase; NY-CO-41
NCBI Protein Information
methyl-CpG-binding domain protein 2
UniProt Protein Name
Methyl-CpG-binding domain protein 2
UniProt Gene Name
MBD2
UniProt Synonym Gene Names
DMTase
Similar Products
Product Notes
The MBD2 mbd2 (Catalog #AAA117744) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 145-411aa; Partial. The amino acid sequence is listed below: ESGKRMDCPA LPPGWKKEEV IRKSGLSAGK SDVYYFSPSG KKFRSKPQLA RYLGNTVDLS SFDFRTGKMM PSKLQKNKQR LRNDPLNQNK GKPDLNTTLP IRQTASIFKQ PVTKVTNHPS NKVKSDPQRM NEQPRQLFWE KRLQGLSASD VTEQIIKTME LPKGLQGVGP GSNDETLLSA VASALHTSSA PITGQVSAAV EKNPAVWLNT SQPLCKAFIV TDEDIRKQEE RVQQVRKKLE EALMADILSR AADTEEMDIE MDSGDEA. It is sometimes possible for the material contained within the vial of "Methyl-CpG-binding domain protein 2 (MBD2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.