SDS-PAGE
Mediator of RNA polymerase II transcription subunit 1 (MED1), partial Recombinant Protein | MED1 recombinant protein
Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial
Gene Names
MED1; PBP; CRSP1; RB18A; TRIP2; PPARBP; CRSP200; DRIP205; DRIP230; PPARGBP; TRAP220
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mediator of RNA polymerase II transcription subunit 1 (MED1), partial; N/A; Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial; Mediator of RNA polymerase II transcription subunit 1; Activator-recruited cofactor 205 kDa component; ARC205; Mediator complex subunit 1; Peroxisome proliferator-activated receptor-binding protein; PBP; PPAR-binding protein; Thyroid hormone receptor-asso; MED1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
878-1031. Partial
Sequence
FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for MED1 recombinant protein
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed:10406464, PubMed:11867769, PubMed:12037571, PubMed:12218053, PubMed:12556447, PubMed:14636573, PubMed:15340084, PubMed:15471764, PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).
Product Categories/Family for MED1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.2 kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 1
NCBI Official Synonym Full Names
mediator complex subunit 1
NCBI Official Symbol
MED1
NCBI Official Synonym Symbols
PBP; CRSP1; RB18A; TRIP2; PPARBP; CRSP200; DRIP205; DRIP230; PPARGBP; TRAP220
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 1; ARC205; TRIP-2; PPAR binding protein; PPAR-binding protein; PPARG binding protein; TR-interacting protein 2; p53 regulatory protein RB18A; thyroid receptor interacting protein 2; thyroid receptor-interacting protein 2; vitamin D receptor-interacting protein 230 kD; activator-recruited cofactor 205 kDa component; peroxisome proliferator-activated receptor-binding protein; vitamin D receptor-interacting protein complex component DRIP205; thyroid hormone receptor-associated protein complex 220 kDa component; thyroid hormone receptor-associated protein complex component TRAP220
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 1
UniProt Gene Name
MED1
UniProt Synonym Gene Names
ARC205; CRSP1; CRSP200; DRIP205; DRIP230; PBP; PPARBP; PPARGBP; RB18A; TRAP220; TRIP2; ARC205; PBP; PPAR-binding protein; Trap220; TR-interacting protein 2; TRIP-2
UniProt Entry Name
MED1_HUMAN
Similar Products
Product Notes
The MED1 med1 (Catalog #AAA117600) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 878-1031. Partial. The amino acid sequence is listed below: FGEEYFDESS QSGDNDDFKG FASQALNTLG VPMLGGDNGE TKFKGNNQAD TVDFSIISVA GKALAPADLM EHHSGSQGPL LTTGDLGKEK TQKRVKEGNG TSNSTLSGPG LDSKPGKRSR TPSNDGKSKD KPPKRKKADT EGKSPSHSSS NRPF. It is sometimes possible for the material contained within the vial of "Mediator of RNA polymerase II transcription subunit 1 (MED1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.