Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282644_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts from HeLa cells using 3 ug [KO Validated] APP Rabbit mAb (AAA282644). Western blot was performed from the immunoprecipitate using [KO Validated] APP Rabbit mAb (AAA282644) at a dilution of 1:1000.)

Rabbit anti-Human APP Monoclonal Antibody | anti-APP antibody

[KO Validated] APP Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
APP, Antibody; [KO Validated] APP Rabbit mAb; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP; PP; anti-APP antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Applicable Applications for anti-APP antibody
ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 671-770 of human APP (P05067).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts from HeLa cells using 3 ug [KO Validated] APP Rabbit mAb (AAA282644). Western blot was performed from the immunoprecipitate using [KO Validated] APP Rabbit mAb (AAA282644) at a dilution of 1:1000.)

product-image-AAA282644_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts from HeLa cells using 3 ug [KO Validated] APP Rabbit mAb (AAA282644). Western blot was performed from the immunoprecipitate using [KO Validated] APP Rabbit mAb (AAA282644) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded 5XFAD Mouse brain and Mouse brain using [KO Validated] APP Rabbit mAb (AAA282644, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.)

product-image-AAA282644_ICC10.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded 5XFAD Mouse brain and Mouse brain using [KO Validated] APP Rabbit mAb (AAA282644, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using APP Rabbit mAb (AAA282644) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA282644_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using APP Rabbit mAb (AAA282644) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] APP Rabbit mAb (AAA282644) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA282644_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates using [KO Validated] APP Rabbit mAb (AAA282644) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and APP knockout (KO) 293T cells, using [KO Validated] APP Rabbit mAb (AAA282644) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA282644_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and APP knockout (KO) 293T cells, using [KO Validated] APP Rabbit mAb (AAA282644) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-APP antibody
This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
351
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 87kDa
Observed MW: 100-140kDa
UniProt Protein Name
Amyloid beta A4 protein
UniProt Gene Name
APP
UniProt Synonym Gene Names
A4; AD1; APP; CVAP; PN-II; S-APP-alpha; S-APP-beta; AICD-59; AID(59); AICD-57; AID(57); AICD-50; AID(50)
UniProt Entry Name
A4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The APP app (Catalog #AAA282644) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] APP Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APP can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the APP app for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDAEFRHDSG YEVHHQKLVF FAEDVGSNKG AIIGLMVGGV VIATVIVITL VMLKKKQYTS IHHGVVEVDA AVTPEERHLS KMQQNGYENP TYKFFEQMQN. It is sometimes possible for the material contained within the vial of "APP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.