Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

anti-Human Defensin, beta-1 (a.a. 1-36) Monoclonal Antibody | anti-DEFB1 antibody

MAb to beta-Defensin-1 (a.a. 1-36)

Average rating 0.0
No ratings yet
Gene Names
DEFB1; BD1; HBD1; DEFB-1; DEFB101; MGC51822
Reactivity
Human
Applications
Western Blot, ELISA
Purity
Protein A chromatography
Synonyms
Defensin, beta-1 (a.a. 1-36), Antibody; MAb to beta-Defensin-1 (a.a. 1-36); Monoclonal Antibody to Human Defensin beta-1 (amino acids 1-36); anti-DEFB1 antibody
Ordering
Host
Host: Mouse.
Source: Cell Culture
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Specificity
Defensin, beta-1 (a.a. 1-36)
Synthetic human beta-Defensin 1 (a.a. 1-36).
Purity/Purification
Protein A chromatography
Form/Format
Purified, Lyophilized
Reconstitute in 10ul double distilled water.
Concentration
1mg/ml (prior to lyophilization) (varies by lot)
Applicable Applications for anti-DEFB1 antibody
WB (Western Blot), ELISA
Immunogen
Synthetic human beta-Defensin 1 (a.a. 1-36). (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Affinity Constant
Not determined.
Buffer
Lyophilized from 50mM Tris, pH 7.4
Preservative
No
Lyophilized
Yes
Important Note
Vial Contains Small Quantity. Centrifuge Product Before Opening!
Preparation and Storage
Store lyophilized product at 2 to 8 degree C. After reconstitution, store at -20 degree C. Avoid multiple freeze/thaw cycles.
Product Categories/Family for anti-DEFB1 antibody
References
• Zucht, H.D., et al., (1998), "Human beta-defensin-1: A urinary peptide present in variant molecular forms and its putative functional implication", Eur. J. Med. Res., 3:315-323.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
7,420 Da
NCBI Official Full Name
Defensin, beta 1
NCBI Official Synonym Full Names
defensin, beta 1
NCBI Official Symbol
DEFB1
NCBI Official Synonym Symbols
BD1; HBD1; DEFB-1; DEFB101; MGC51822
NCBI Protein Information
beta-defensin 1; BD-1; beta-defensin-1; OTTHUMP00000159500
UniProt Protein Name
Beta-defensin 1
UniProt Gene Name
DEFB1
UniProt Synonym Gene Names
BD1; HBD1
UniProt Entry Name
DEFB1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DEFB1 defb1 (Catalog #AAA57873) is an Antibody produced from Host: Mouse. Source: Cell Culture and is intended for research purposes only. The product is available for immediate purchase. The MAb to beta-Defensin-1 (a.a. 1-36) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Defensin, beta-1 (a.a. 1-36) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the DEFB1 defb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Defensin, beta-1 (a.a. 1-36), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.