Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded human spleen using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human Heme Oxygenase 1 (HO-1/HMOX1) Monoclonal Antibody | anti-HMOX1 antibody

[KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
Heme Oxygenase 1 (HO-1/HMOX1); Monoclonal Antibody; [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb; HO-1; HSP32; HMOX1D; bK286B10; anti-HMOX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA
Applicable Applications for anti-HMOX1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
Application Notes
WB: 1:2000-1:10000
IHC-P: 1:200-1:800
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1)(NP_002124.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of paraffin-embedded human spleen using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of paraffin-embedded human spleen using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockdown (KD) HeLa cells, using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot) (Western blot analysis of lysates from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockdown (KD) HeLa cells, using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of lysates from HepG2 cells, using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot) (Western blot analysis of lysates from HepG2 cells, using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of lysates from Raw264.7 cells, using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

WB (Western Blot) (Western blot analysis of lysates from Raw264.7 cells, using [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (AAA28478) at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-HMOX1 antibody
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 33kDa
Observed MW: 33kDa
UniProt Protein Name
Heme oxygenase 1
UniProt Gene Name
HMOX1
UniProt Synonym Gene Names
HO; HO1; HO-1
UniProt Entry Name
HMOX1_HUMAN

Similar Products

Product Notes

The HMOX1 hmox1 (Catalog #AAA28478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Heme Oxygenase 1 (HO-1/HMOX1) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA). WB: 1:2000-1:10000 IHC-P: 1:200-1:800 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the HMOX1 hmox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERPQPDSMP QDLSEALKEA TKEVHTQAEN AEFMRNFQKG QVTRDGFKLV MASLYHIYVA LEEEIERNKE SPVFAPVYFP EELHRKAALE QDLAFWYGPR WQEVIPYTPA MQRYVKRLHE VGRTEPELLV AHAYTRYLGD LSGGQVLKKI AQKALDLPSS GEGLAFFTFP NIASATKFKQ LYRSRMNSLE MTPAVRQRVI EEAKTAFLLN IQLFEELQEL LTHDTKDQSP SRAPGLRQRA SNKVQDSAPV ETPRGKPPLN TRSQA. It is sometimes possible for the material contained within the vial of "Heme Oxygenase 1 (HO-1/HMOX1), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.