Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25433_WB7.jpg WB (Western Blot) (TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in Hela NE)

Mouse KAP-1 Monoclonal Antibody | anti-KAP-1 antibody

KAP-1 (Transcription Intermediary Factor 1-beta, TIF1-beta, E3 SUMO-protein Ligase TRIM28, KRAB-associated Protein 1, KRAB-interacting Protein 1, KRIP-1, Nuclear Corepressor KAP-1, RING Finger Protein 96, Tripartite Motif-containing Protein 28, TRIM28, KA

Gene Names
TRIM28; KAP1; TF1B; RNF96; TIF1B; PPP1R157
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KAP-1, Antibody; KAP-1 (Transcription Intermediary Factor 1-beta, TIF1-beta, E3 SUMO-protein Ligase TRIM28, KRAB-associated Protein 1, KRAB-interacting Protein 1, KRIP-1, Nuclear Corepressor KAP-1, RING Finger Protein 96, Tripartite Motif-containing Protein 28, TRIM28, KA; anti-KAP-1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E6
Specificity
Recognizes human TRIM28. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2989
Applicable Applications for anti-KAP-1 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa379-524 from TRIM28 (AAH04978) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in Hela NE)

product-image-AAA25433_WB7.jpg WB (Western Blot) (TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in Hela NE)

WB (Western Blot)

(TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in PC-12)

product-image-AAA25433_WB6.jpg WB (Western Blot) (TRIM28 monoclonal antibody Western Blot analysis of TRIM28 expression in PC-12)

WB (Western Blot)

(Western blot analysis of TRIM28 over-expressed 293 cell line, cotransfected with TRIM28 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM28 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25433_WB5.jpg WB (Western Blot) (Western blot analysis of TRIM28 over-expressed 293 cell line, cotransfected with TRIM28 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM28 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TRIM28 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA25433_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TRIM28 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

product-image-AAA25433_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody Lane 1: TRIM28 transfected lysate (88.5kD). Lane 2: Non-transfected lysate)

product-image-AAA25433_WB2.jpg WB (Western Blot) (Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody Lane 1: TRIM28 transfected lysate (88.5kD). Lane 2: Non-transfected lysate)

WB (Western Blot)

(Western Blot detection against Immunogen (41.69kD).)

product-image-AAA25433_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (41.69kD).)
Product Categories/Family for anti-KAP-1 antibody
References
1. Multipotent Adult Germline Stem Cells and Embryonic Stem Cells Functional Proteomics Revealed an Important Role of Eukaryotic Initiation Factor 5A (Eif5a) in Stem Cell Differentiation. Dihazi H, Dihazi GH, Jahn O, Meyer S, Nolte J, Asif AR, Mueller GA, Engel W.J Proteome Res. 2011 Feb 24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens tripartite motif-containing 28, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 28
NCBI Official Symbol
TRIM28
NCBI Official Synonym Symbols
KAP1; TF1B; RNF96; TIF1B; PPP1R157
NCBI Protein Information
transcription intermediary factor 1-beta

Similar Products

Product Notes

The KAP-1 (Catalog #AAA25433) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KAP-1 (Transcription Intermediary Factor 1-beta, TIF1-beta, E3 SUMO-protein Ligase TRIM28, KRAB-associated Protein 1, KRAB-interacting Protein 1, KRIP-1, Nuclear Corepressor KAP-1, RING Finger Protein 96, Tripartite Motif-containing Protein 28, TRIM28, KA reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KAP-1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KAP-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KAP-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.