Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126877_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of A431 cells using anti-p95 NBS1 antibody (AAA126877).Overlay histogram showing A431 cells stained with AAA126877 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-p95 NBS1 Antibody (AAA126877, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse p95 NBS1 Monoclonal Antibody | anti-NBN antibody

Anti-p95 NBS1 Antibody Picoband (monoclonal, 5D7A1)

Gene Names
NBN; ATV; NBS; P95; NBS1; AT-V1; AT-V2
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
p95 NBS1, Antibody; Anti-p95 NBS1 Antibody Picoband (monoclonal, 5D7A1); anti-NBN antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG2a
Clone Number
5D7A1
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-NBN antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of A431 cells using anti-p95 NBS1 antibody (AAA126877).Overlay histogram showing A431 cells stained with AAA126877 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-p95 NBS1 Antibody (AAA126877, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126877_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of A431 cells using anti-p95 NBS1 antibody (AAA126877).Overlay histogram showing A431 cells stained with AAA126877 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-p95 NBS1 Antibody (AAA126877, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 3. IF analysis of p95 NBS1 using anti-p95 NBS1 antibody (AAA126877).p95 NBS1 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-p95 NBS1 Antibody (AAA126877) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA126877_IF11.jpg IF (Immunofluorescence) (Figure 3. IF analysis of p95 NBS1 using anti-p95 NBS1 antibody (AAA126877).p95 NBS1 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-p95 NBS1 Antibody (AAA126877) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody (AAA126877).p95 NBS1 was detected in a paraffin-embedded section of human testis cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-p95 NBS1 Antibody (AAA126877) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA126877_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody (AAA126877).p95 NBS1 was detected in a paraffin-embedded section of human testis cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-p95 NBS1 Antibody (AAA126877) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of p95 NBS1 using anti-p95 NBS1 antibody (AAA126877).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human A549 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat testis tissue lysates,Lane 5: mouse brain tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-p95 NBS1 antigen affinity purified monoclonal antibody (#AAA126877) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for p95 NBS1 at approximately 95 kDa. The expected band size for p95 NBS1 is at 95 kDa.)

product-image-AAA126877_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of p95 NBS1 using anti-p95 NBS1 antibody (AAA126877).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human A549 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat testis tissue lysates,Lane 5: mouse brain tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-p95 NBS1 antigen affinity purified monoclonal antibody (#AAA126877) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for p95 NBS1 at approximately 95 kDa. The expected band size for p95 NBS1 is at 95 kDa.)
Related Product Information for anti-NBN antibody
p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).
Product Categories/Family for anti-NBN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,959 Da
NCBI Official Full Name
nibrin
NCBI Official Synonym Full Names
nibrin
NCBI Official Symbol
NBN
NCBI Official Synonym Symbols
ATV; NBS; P95; NBS1; AT-V1; AT-V2
NCBI Protein Information
nibrin; cell cycle regulatory protein p95; Nijmegen breakage syndrome 1 (nibrin); p95 protein of the MRE11/RAD50 complex
UniProt Protein Name
Nibrin
UniProt Gene Name
NBN
UniProt Synonym Gene Names
NBS; NBS1; P95
UniProt Entry Name
NBN_HUMAN

Similar Products

Product Notes

The NBN nbn (Catalog #AAA126877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-p95 NBS1 Antibody Picoband (monoclonal, 5D7A1) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's p95 NBS1 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NBN nbn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "p95 NBS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.