Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282774_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat skeletal muscle tissue using SERCA1/ATP2A1 Rabbit mAb (AAA282774, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

Rabbit anti-Human SERCA1/ATP2A1 Monoclonal Antibody | anti-ATP2A1 antibody

SERCA1/ATP2A1 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
SERCA1/ATP2A1, Antibody; SERCA1/ATP2A1 Rabbit mAb; ATP2A; SERCA1; SERCA1/ATP2A1; anti-ATP2A1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
ALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK
Applicable Applications for anti-ATP2A1 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 900-1001 of human SERCA1/ATP2A1 (O14983).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat skeletal muscle tissue using SERCA1/ATP2A1 Rabbit mAb (AAA282774, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA282774_ICC11.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat skeletal muscle tissue using SERCA1/ATP2A1 Rabbit mAb (AAA282774, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse skeletal muscle tissue using SERCA1/ATP2A1 Rabbit mAb (AAA282774, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA282774_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse skeletal muscle tissue using SERCA1/ATP2A1 Rabbit mAb (AAA282774, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse skeletal muscle, using SERCA1/ATP2A1 Rabbit mAb (AAA282774) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282774_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse skeletal muscle, using SERCA1/ATP2A1 Rabbit mAb (AAA282774) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-ATP2A1 antibody
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in three transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
487
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 95kDa/110kDa
Observed MW: 110kDa
UniProt Protein Name
Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
UniProt Gene Name
ATP2A1
UniProt Synonym Gene Names
SERCA1
UniProt Entry Name
AT2A1_HUMAN

Similar Products

Product Notes

The ATP2A1 atp2a1 (Catalog #AAA282774) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERCA1/ATP2A1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERCA1/ATP2A1 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ATP2A1 atp2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALSVLVTIEM CNALNSLSEN QSLLRMPPWV NIWLLGSICL SMSLHFLILY VDPLPMIFKL RALDLTQWLM VLKISLPVIG LDEILKFVAR NYLEDPEDER RK. It is sometimes possible for the material contained within the vial of "SERCA1/ATP2A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.