IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug TSC2 antibody (AAA282731). Western blot was performed from the immunoprecipitate using TSC2 antibody (AAA282731) at a dilution of 1:1000.)
Rabbit anti-Human TSC2 Monoclonal Antibody | anti-TSC2 antibody
TSC2 Rabbit mAb
Reactivity
Human
Purity
Affinity purification
Synonyms
TSC2, Antibody; TSC2 Rabbit mAb; LAM; TSC4; PPP1R160; TSC2; anti-TSC2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
AKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1700-1807 of human Tuberin (P49815).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug TSC2 antibody (AAA282731). Western blot was performed from the immunoprecipitate using TSC2 antibody (AAA282731) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug TSC2 antibody (AAA282731). Western blot was performed from the immunoprecipitate using TSC2 antibody (AAA282731) at a dilution of 1:1000.)
WB (Western Blot)
(Western blot analysis of various lysates using TSC2 Rabbit mAb (AAA282731) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates using TSC2 Rabbit mAb (AAA282731) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-TSC2 antibody
This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.
Product Categories/Family for anti-TSC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 201kDa
Observed MW: 200kDa
Observed MW: 200kDa
UniProt Protein Name
Tuberin
UniProt Gene Name
TSC2
UniProt Synonym Gene Names
TSC4
UniProt Entry Name
TSC2_HUMAN
Similar Products
Product Notes
The TSC2 tsc2 (Catalog #AAA282731) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSC2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: AKIVSDRNLP FVARQMALHA NMASQVHHSR SNPTDIYPSK WIARLRHIKR LRQRICEEAA YSNPSLPLVH PPSHSKAPAQ TPAEPTPGYE VGQRKRLISS VEDFTEFV. It is sometimes possible for the material contained within the vial of "TSC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.