Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug YAP1 antibody (AAA28495). Western blot was performed from the immunoprecipitate using YAP1 antibody (AAA28495) at a dilution of 1:500.)

Rabbit anti-Human YAP1 Monoclonal Antibody | anti-YAP1 antibody

[KO Validated] YAP1 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
YAP1, Antibody; [KO Validated] YAP1 Rabbit mAb; YAP; YKI; COB1; YAP2; YAP-1; YAP65; P1; anti-YAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Applicable Applications for anti-YAP1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
Application Notes
WB: 1:10000-1:40000
IHC-P: 1:200-1:2000
IF/ICC: 1:100-1:400
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug YAP1 antibody (AAA28495). Western blot was performed from the immunoprecipitate using YAP1 antibody (AAA28495) at a dilution of 1:500.)

IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug YAP1 antibody (AAA28495). Western blot was performed from the immunoprecipitate using YAP1 antibody (AAA28495) at a dilution of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U20S cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of U20S cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] YAP1 Rabbit mAb (AAA28495) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO) HeLa cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at 1:10000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO) HeLa cells using [KO Validated] YAP1 Rabbit mAb (AAA28495) at 1:10000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-YAP1 antibody
This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Observed MW: 70kDa
UniProt Protein Name
Yorkie homolog
UniProt Gene Name
YAP1
UniProt Synonym Gene Names
YAP65; YAP65
UniProt Entry Name
YAP1_HUMAN

Similar Products

Product Notes

The YAP1 yap1 (Catalog #AAA28495) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] YAP1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's YAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA). WB: 1:10000-1:40000 IHC-P: 1:200-1:2000 IF/ICC: 1:100-1:400 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the YAP1 yap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PTAQHLRQSS FEIPDDVPLP AGWEMAKTSS GQRYFLNHID QTTTWQDPRK AMLSQMNVTA PTSPPVQQNM MNSASGPLPD GWEQAMTQDG EIYYINHKNK TTSWLDPRLD PRFAMNQRIS QSAPVKQPPP LAPQSPQGGV MGGSNSNQQQ QMRLQQLQME KERLRLKQQE LLRQAMRNIN PSTANSPKCQ ELALRSQLPT LEQDGGTQNP VSSPGMSQEL RTMTTNSSDP FLNSGTYHSR DESTDSGLSM SSYSVPRTPD DFLNSVDEMD TGDTINQSTL PSQQNRFPDY LEAIPGTNVD LGTLEGDGMN IEGEELMPSL QEALSSDILN DMESVLAATK LDKESFLTWL. It is sometimes possible for the material contained within the vial of "YAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.