Notch homolog 2 N-terminal-like B (NOTCH2NLB) Recombinant Protein | NOTCH2NLB recombinant protein
Recombinant Human Notch homolog 2 N-terminal-like protein B (NOTCH2NLB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Notch homolog 2 N-terminal-like B (NOTCH2NLB); N/A; Recombinant Human Notch homolog 2 N-terminal-like protein B (NOTCH2NLB); NOTCH2NLB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
26-275aa; Full Length of Mature Protein
Sequence
LQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
Species
Human
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Function
Human-specific protein that promotes neural progenitor proliferation and evolutionary expansion of the brain neocortex by regulating the Notch signaling pathway (PubMed:29856954, PubMed:29856955, PubMed:29561261). Able to promote neural progenitor self-renewal, possibly by down-regulating neuronal differentiation genes, thereby delaying the differentiation of neuronal progenitors and leading to an overall final increase in neuronal production (PubMed:29856954, PubMed:29856955). Acts by enhancing the Notch signaling pathway via two different mechanisms that probably work in parallel to reach the same effect (PubMed:29856954, PubMed:29856955). Enhances Notch signaling pathway in a non-cell-autonomous manner via direct interaction with NOTCH2 (PubMed:29856954). Also promotes Notch signaling pathway in a cell-autonomous manner through inhibition of cis DLL1-NOTCH2 interactions, which promotes neuronal differentiation (PubMed:29856955).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for NOTCH2NLB recombinant protein
References
"Human-specific NOTCH2NL genes affect Notch signaling and cortical neurogenesis."Fiddes I.T., Lodewijk G.A., Mooring M., Bosworth C.M., Ewing A.D., Mantalas G.L., Novak A.M., van den Bout A., Bishara A., Rosenkrantz J.L., Lorig-Roach R., Field A.R., Haeussler M., Russo L., Bhaduri A., Nowakowski T.J., Pollen A.A., Dougherty M.L. Haussler D.Cell 173:1356-1369 (2018)
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
31.3kDa
Similar Products
Product Notes
The NOTCH2NLB (Catalog #AAA244047) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-275aa; Full Length of Mature Protein. The amino acid sequence is listed below: LQCRDGYEPC VNEGMCVTYH NGTGYCKCPE GFLGEYCQHR DPCEKNRCQN GGTCVAQAML GKATCRCASG FTGEDCQYST SHPCFVSRPC LNGGTCHMLS RDTYECTCQV GFTGKECQWT DACLSHPCAN GSTCTTVANQ FSCKCLTGFT GQKCETDVNE CDIPGHCQHG GICLNLPGSY QCQCLQGFTG QYCDSLYVPC APSPCVNGGT CRQTGDFTFE CNCLPETVRR GTELWERDRE VWNGKEHDEN. It is sometimes possible for the material contained within the vial of "Notch homolog 2 N-terminal-like B (NOTCH2NLB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.