Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200483_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACOT11 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateACOT11 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit ACOT11 Polyclonal Antibody | anti-ACOT11 antibody

ACOT11 antibody - middle region

Gene Names
ACOT11; BFIT; THEA; THEM1; STARD14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACOT11, Antibody; ACOT11 antibody - middle region; anti-ACOT11 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
Sequence Length
594
Applicable Applications for anti-ACOT11 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACOT11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACOT11 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateACOT11 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200483_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACOT11 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateACOT11 is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemistry)

(Rabbit Anti-ACOT11 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult HeartObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200483_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ACOT11 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult HeartObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ACOT11 antibody
This is a rabbit polyclonal antibody against ACOT11. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.
Product Categories/Family for anti-ACOT11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65
NCBI Official Full Name
acyl-coenzyme A thioesterase 11 isoform 2
NCBI Official Synonym Full Names
acyl-CoA thioesterase 11
NCBI Official Symbol
ACOT11
NCBI Official Synonym Symbols
BFIT; THEA; THEM1; STARD14
NCBI Protein Information
acyl-coenzyme A thioesterase 11

Similar Products

Product Notes

The ACOT11 (Catalog #AAA200483) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACOT11 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACOT11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ACOT11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEKTRVESVE LVLPPHANHQ GNTFGGQIMA WMENVATIAA SRLCRAHPTL. It is sometimes possible for the material contained within the vial of "ACOT11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.