IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit AMPKalpha1 Polyclonal Antibody | anti-AMPKalpha1 antibody
AMPKalpha1 Rabbit pAb
Gene Names
ATPIF1; IP; ATPI; ATPIP
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
AMPKalpha1, Antibody; AMPKalpha1 Rabbit pAb; PRKAA1; AMPK; AMPKa1; protein kinase AMP-activated catalytic subunit alpha 1; anti-AMPKalpha1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
Applicable Applications for anti-AMPKalpha1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 450-559 of human AMPKalpha1 (NP_006242.5).
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using AMPKalpha1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-AMPKalpha1 antibody
The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Product Categories/Family for anti-AMPKalpha1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
106
NCBI Official Full Name
ATPase inhibitor, mitochondrial
NCBI Official Synonym Full Names
ATPase inhibitory factor 1
NCBI Official Symbol
ATPIF1
NCBI Official Synonym Symbols
IP; ATPI; ATPIP
NCBI Protein Information
ATPase inhibitor, mitochondrial; IF1; ATPase inhibitor protein; inhibitor of F(1)F(o)-ATPase; ATP synthase inhibitor protein
UniProt Protein Name
ATPase inhibitor, mitochondrial
UniProt Gene Name
ATPIF1
UniProt Synonym Gene Names
ATPI; IF(1); IF1
UniProt Entry Name
ATIF1_HUMAN
Similar Products
Product Notes
The AMPKalpha1 atpif1 (Catalog #AAA282320) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMPKalpha1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AMPKalpha1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the AMPKalpha1 atpif1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GSDQSENVDR GAGSIREAGG AFGKREQAEE ERYFRAQSRE QLAALKKHHE EEIVHHKKEI ERLQKEIERH KQKIKMLKHD D. It is sometimes possible for the material contained within the vial of "AMPKalpha1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.