Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197127_WB13.jpg WB (Western Blot) (WB Suggested Anti-Arnt Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Liver)

Rabbit Arnt Polyclonal Antibody | anti-ARNT antibody

Arnt antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Arnt; Arnt1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Arnt, Antibody; Arnt antibody - C-terminal region; anti-ARNT antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE
Sequence Length
800
Applicable Applications for anti-ARNT antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Arnt Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Liver)

product-image-AAA197127_WB13.jpg WB (Western Blot) (WB Suggested Anti-Arnt Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Liver)

IHC (Immunohistochemistry)

(Researcher: Hiten D. Mistry, King's College LondonApplication: IHCSpecies + Tissue/Cell type: Human placentaPrimary antibody dilution: 1:200Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:5000)

product-image-AAA197127_IHC15.jpg IHC (Immunohistochemistry) (Researcher: Hiten D. Mistry, King's College LondonApplication: IHCSpecies + Tissue/Cell type: Human placentaPrimary antibody dilution: 1:200Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:5000)
Related Product Information for anti-ARNT antibody
This is a rabbit polyclonal antibody against Arnt. It was validated on Western Blot

Target Description: Arnt is required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
aryl hydrocarbon receptor nuclear translocator
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator
NCBI Official Symbol
Arnt
NCBI Official Synonym Symbols
Arnt1
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator
UniProt Protein Name
Aryl hydrocarbon receptor nuclear translocator
UniProt Gene Name
Arnt
UniProt Synonym Gene Names
ARNT protein; HIF-1-beta; HIF1-beta
UniProt Entry Name
ARNT_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ARNT arnt (Catalog #AAA197127) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Arnt antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Arnt can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ARNT arnt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNEQHVQPTS AQPSSQPEVF QEMLSMLGDQ SNTYNNEEFP DLTMFPPFSE. It is sometimes possible for the material contained within the vial of "Arnt, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.