Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281723_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit CCL19 Polyclonal Antibody | anti-CCL19 antibody

CCL19 Rabbit pAb

Gene Names
CCL19; ELC; CKb11; MIP3B; MIP-3b; SCYA19
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
CCL19, Antibody; CCL19 Rabbit pAb; CCL19; CKb11; ELC; MIP-3b; MIP3B; SCYA19; anti-CCL19 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR
Applicable Applications for anti-CCL19 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 22-95 of human CCL19 (NP_006265.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281723_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of human spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281723_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of human spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281723_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat spleen using CCL19 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of rat lung, using CCL19 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281723_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of rat lung, using CCL19 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CCL19 antibody
Background: This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
10,993 Da
NCBI Official Full Name
macrophage inflammatory protein 3 beta
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 19
NCBI Official Symbol
CCL19
NCBI Official Synonym Symbols
ELC; CKb11; MIP3B; MIP-3b; SCYA19
NCBI Protein Information
C-C motif chemokine 19; exodus-3; CK beta-11; MIP-3-beta; EBI1 ligand chemokine; EBI1-ligand chemokine; CC chemokine ligand 19; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3 beta; macroph
UniProt Protein Name
C-C motif chemokine 19
UniProt Gene Name
CCL19
UniProt Synonym Gene Names
ELC; MIP3B; SCYA19; EBI1 ligand chemokine; ELC; MIP-3-beta
UniProt Entry Name
CCL19_HUMAN

Similar Products

Product Notes

The CCL19 ccl19 (Catalog #AAA281723) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL19 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCL19 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the CCL19 ccl19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GTNDAEDCCL SVTQKPIPGY IVRNFHYLLI KDGCRVPAVV FTTLRGRQLC APPDQPWVER IIQRLQRTSA KMKR. It is sometimes possible for the material contained within the vial of "CCL19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.