Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282427_AD10.jpg Application Data (Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of rat spleen cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human CD45RB Polyclonal Antibody | anti-CD45RB antibody

CD45RB Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PTPRC; LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
CD45RB, Antibody; CD45RB Rabbit pAb; LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; IMD105; anti-CD45RB antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
GMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
Applicable Applications for anti-CD45RB antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Jurkat
Cellular Location
Membrane, Membrane raft, Single-pass type I membrane protein
Research Area
Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Neuroscience, Cell Type Marker, Stem Cells, Hematopoietic Progenitors
Immunogen
Recombinant protein of human CD45RB.
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

Application Data

(Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of rat spleen cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282427_AD10.jpg Application Data (Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of rat spleen cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Application Data

(Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of mouse spleen cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282427_AD11.jpg Application Data (Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of mouse spleen cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Jurkat cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282427_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Jurkat cells using CD45RB Rabbit pAb (AAA282427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of Jurkat, using CD45RB Rabbit pAb (AAA282427) at 1:1500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA282427_WB15.jpg WB (Western Blot) (Western blot analysis of Jurkat, using CD45RB Rabbit pAb (AAA282427) at 1:1500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)
Related Product Information for anti-CD45RB antibody
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.
Product Categories/Family for anti-CD45RB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
147,254 Da
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase C isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type, C
NCBI Official Symbol
PTPRC
NCBI Official Synonym Symbols
LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180
NCBI Protein Information
receptor-type tyrosine-protein phosphatase C; CD45 antigen; T200 glycoprotein; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase C
UniProt Gene Name
PTPRC
UniProt Synonym Gene Names
CD45; L-CA
UniProt Entry Name
PTPRC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD45RB ptprc (Catalog #AAA282427) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD45RB Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD45RB can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the CD45RB ptprc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GMVSTFEQYQ FLYDVIASTY PAQNGQVKKN NHQEDKIEFD NEVDKVKQDA NCVNPLGAPE KLPEAKEQAE GSEPTSGTEG PEHSVNGPAS PALNQGS. It is sometimes possible for the material contained within the vial of "CD45RB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.