Rabbit CH25H Polyclonal Antibody | anti-CH25H antibody
CH25H Antibody - C-terminal region
Gene Names
CH25H; C25H
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CH25H, Antibody; CH25H Antibody - C-terminal region; anti-CH25H antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Predicted Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH
Applicable Applications for anti-CH25H antibody
WB (Western Blot)
Protein Size (# AA)
272 amino acids
Blocking Peptide
For anti-CH25H (MBS3216814) antibody is Catalog # MBS3241714
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CH25H
Replacement Item
This antibody may replace item sc-107479 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 93%; Goat: 83%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 75%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CH25H antibody
This is a rabbit polyclonal antibody against CH25H. It was validated on Western Blot
Target Description: This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates.
Target Description: This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates.
Product Categories/Family for anti-CH25H antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
cholesterol 25-hydroxylase
NCBI Official Synonym Full Names
cholesterol 25-hydroxylase
NCBI Official Symbol
CH25H
NCBI Official Synonym Symbols
C25H
NCBI Protein Information
cholesterol 25-hydroxylase
UniProt Protein Name
Cholesterol 25-hydroxylase
UniProt Gene Name
CH25H
UniProt Synonym Gene Names
h25OH
Similar Products
Product Notes
The CH25H ch25h (Catalog #AAA201341) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CH25H Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CH25H can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CH25H ch25h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VTLLGCHPLT TLTFHVVNIW LSVEDHSGYN FPWSTHRLVP FGWYGGVVHH. It is sometimes possible for the material contained within the vial of "CH25H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
