Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA280991_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using CTCF antibody at dilution of 1:100 (40x lens).)

Rabbit CTCF Polyclonal Antibody | anti-CTCF antibody

CTCF Polyclonal Antibody

Gene Names
CTCF; MRD21
Reactivity
Human, Mouse, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
CTCF, Antibody; CTCF Polyclonal Antibody; MRD21; anti-CTCF antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPT
Sequence Length
399
Applicable Applications for anti-CTCF antibody
ChIP (Chromatin immunoprecipitation), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human CTCF
Immunogen Species
Human
Cellular Location
Chromosome, Nucleus, centromere, nucleoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using CTCF antibody at dilution of 1:100 (40x lens).)

product-image-AAA280991_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using CTCF antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse brain using CTCF antibody at dilution of 1:100 (20x lens).)

product-image-AAA280991_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse brain using CTCF antibody at dilution of 1:100 (20x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat brain using CTCF antibody at dilution of 1:100 (20x lens).)

product-image-AAA280991_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat brain using CTCF antibody at dilution of 1:100 (20x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CTCF antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA280991_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CTCF antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-CTCF antibody
This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CTCF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 82kDa
Observed: 135kDa
NCBI Official Full Name
transcriptional repressor CTCF isoform 2
NCBI Official Synonym Full Names
CCCTC-binding factor
NCBI Official Symbol
CTCF
NCBI Official Synonym Symbols
MRD21
NCBI Protein Information
transcriptional repressor CTCF
UniProt Protein Name
Transcriptional repressor CTCF
UniProt Gene Name
CTCF

Similar Products

Product Notes

The CTCF ctcf (Catalog #AAA280991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTCF Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTCF can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CTCF ctcf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEGDAVEAIV EESETFIKGK ERKTYQRRRE GGQEEDACHL PQNQTDGGEV VQDVNSSVQM VMMEQLDPTL LQMKTEVMEG TVAPEAEAAV DDTQIITLQV VNMEEQPINI GELQLVQVPV PVTVPVATTS VEELQGAYEN EVSKEGLAES EPMICHTLPL PEGFQVVKVG ANGEVETLEQ GELPPQEDPS WQKDPDYQPP AKKTKKTKKS KLRYTEEGKD VDVSVYDFEE EQQEGLLSEV NAEKVVGNMK PPKPT. It is sometimes possible for the material contained within the vial of "CTCF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.