Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197382_WB11.jpg WB (Western Blot) (WB Suggested Anti-EHMT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit EHMT2 Polyclonal Antibody | anti-EHMT2 antibody

EHMT2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
EHMT2; G9A; BAT8; GAT8; NG36; KMT1C; C6orf30
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
EHMT2, Antibody; EHMT2 antibody - N-terminal region; anti-EHMT2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
Sequence Length
1210
Applicable Applications for anti-EHMT2 antibody
WB (Western Blot), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EHMT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

product-image-AAA197382_WB11.jpg WB (Western Blot) (WB Suggested Anti-EHMT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

WB (Western Blot)

(WB Suggested Anti-EHMT2 AntibodyPositive Control: Lane 1: 30ug human RKO lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680Secondry Antibody Dilution : 1:5000Submitted by: Dr. Syed Morshed)

product-image-AAA197382_WB13.jpg WB (Western Blot) (WB Suggested Anti-EHMT2 AntibodyPositive Control: Lane 1: 30ug human RKO lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680Secondry Antibody Dilution : 1:5000Submitted by: Dr. Syed Morshed)

ChIP (Chromatin Immunoprecipitation)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

product-image-AAA197382_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
Related Product Information for anti-EHMT2 antibody
This is a rabbit polyclonal antibody against EHMT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction. There are three alternatively spliced transcript variants of this gene but only two are fully described.
Product Categories/Family for anti-EHMT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
132kDa
NCBI Official Full Name
histone-lysine N-methyltransferase EHMT2 isoform a
NCBI Official Synonym Full Names
euchromatic histone lysine methyltransferase 2
NCBI Official Symbol
EHMT2
NCBI Official Synonym Symbols
G9A; BAT8; GAT8; NG36; KMT1C; C6orf30
NCBI Protein Information
histone-lysine N-methyltransferase EHMT2
UniProt Protein Name
Histone-lysine N-methyltransferase EHMT2
UniProt Gene Name
EHMT2
UniProt Synonym Gene Names
BAT8; C6orf30; G9A; KMT1C; NG36; H3-K9-HMTase 3
UniProt Entry Name
EHMT2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EHMT2 ehmt2 (Catalog #AAA197382) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EHMT2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EHMT2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the EHMT2 ehmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQSLAMRLLS MPGAQGAAAA GSEPPPATTS PEGQPKVHRA RKTMSKPGNG. It is sometimes possible for the material contained within the vial of "EHMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.