Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281706_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using FXN / Frataxin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit FXN Polyclonal Antibody | anti-FXN antibody

FXN Rabbit pAb

Gene Names
FXN; FA; X25; CyaY; FARR; FRDA
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
FXN, Antibody; FXN Rabbit pAb; FXN; CyaY; FA; FARR; FRDA; X25; frataxin; anti-FXN antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Applicable Applications for anti-FXN antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 42-210 of human FXN (NP_000135.2).
Cellular Location
Cytoplasm, Mitochondrion
Positive Samples
K-562, U-87MG, Jurkat
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using FXN / Frataxin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281706_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using FXN / Frataxin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using FXN / Frataxin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281706_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using FXN / Frataxin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded rat pancreas using FXN / Frataxin antibody at dilution of 1:100 (40x lens).)

product-image-AAA281706_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded rat pancreas using FXN / Frataxin antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat lung using FXN / Frataxin antibody at dilution of 1:100 (40x lens).)

product-image-AAA281706_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat lung using FXN / Frataxin antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using FXN Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281706_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using FXN Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-FXN antibody
Background: This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-FXN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
210
NCBI Official Full Name
Frataxin, mitochondrial
NCBI Official Synonym Full Names
frataxin
NCBI Official Symbol
FXN
NCBI Official Synonym Symbols
FA; X25; CyaY; FARR; FRDA
NCBI Protein Information
frataxin, mitochondrial; Friedreich ataxia protein
UniProt Protein Name
Frataxin, mitochondrial
UniProt Gene Name
FXN
UniProt Synonym Gene Names
FRDA; X25; Fxn; i-FXN
UniProt Entry Name
FRDA_HUMAN

Similar Products

Product Notes

The FXN fxn (Catalog #AAA281706) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FXN Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FXN can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FXN fxn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LRTDIDATCT PRRASSNQRG LNQIWNVKKQ SVYLMNLRKS GTLGHPGSLD ETTYERLAEE TLDSLAEFFE DLADKPYTFE DYDVSFGSGV LTVKLGGDLG TYVINKQTPN KQIWLSSPSS GPKRYDWTGK NWVYSHDGVS LHELLAAELT KALKTKLDLS SLAYSGKDA. It is sometimes possible for the material contained within the vial of "FXN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.