Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198095_WB10.jpg WB (Western Blot) (WB Suggested Anti-GJA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit GJA1 Polyclonal Antibody | anti-GJA1 antibody

GJA1 antibody - N-terminal region

Gene Names
GJA1; HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GJA1, Antibody; GJA1 antibody - N-terminal region; anti-GJA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE
Sequence Length
382
Applicable Applications for anti-GJA1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GJA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GJA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

product-image-AAA198095_WB10.jpg WB (Western Blot) (WB Suggested Anti-GJA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

WB (Western Blot)

(WB Suggested Anti-GJA1 AntibodyPositive Control: Lane1: 60ug rat stiatumPrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-IRDye800Secondry Antibody Dilution : 1:10,000Submitted by: Ruben van Vugt, The Nijmegen Centre for Molecular Life Sciences (NCMLS))

product-image-AAA198095_WB11.jpg WB (Western Blot) (WB Suggested Anti-GJA1 AntibodyPositive Control: Lane1: 60ug rat stiatumPrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-IRDye800Secondry Antibody Dilution : 1:10,000Submitted by: Ruben van Vugt, The Nijmegen Centre for Molecular Life Sciences (NCMLS))

WB (Western Blot)

(Species+tissue/cell type: Total rat cardiac lysate1: 8 ug total cardiac lysate2: 15 ug total cardiac lysate3: 30 ug total cardiac lysate4: 50 ug total cardiac lysatePrimary antibody dilution: 0.25 ug/ml)

product-image-AAA198095_WB13.jpg WB (Western Blot) (Species+tissue/cell type: Total rat cardiac lysate1: 8 ug total cardiac lysate2: 15 ug total cardiac lysate3: 30 ug total cardiac lysate4: 50 ug total cardiac lysatePrimary antibody dilution: 0.25 ug/ml)

WB (Western Blot)

(Lanes:Lane1: 8 ug total cardiac lysateLane2: 15 ug total cardiac lysateLane3: 30 ug total cardiac lysateLane4: 50 ug total cardiac lysatePrimary Antibody Dilution:0.25 ug/mlSecondary Antibody:Secondary Antibody Dilution:Gene Name:GJA1Submitted by:Anonymous)

product-image-AAA198095_WB15.jpg WB (Western Blot) (Lanes:Lane1: 8 ug total cardiac lysateLane2: 15 ug total cardiac lysateLane3: 30 ug total cardiac lysateLane4: 50 ug total cardiac lysatePrimary Antibody Dilution:0.25 ug/mlSecondary Antibody:Secondary Antibody Dilution:Gene Name:GJA1Submitted by:Anonymous)
Related Product Information for anti-GJA1 antibody
This is a rabbit polyclonal antibody against GJA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
gap junction alpha-1 protein
NCBI Official Synonym Full Names
gap junction protein alpha 1
NCBI Official Symbol
GJA1
NCBI Official Synonym Symbols
HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA
NCBI Protein Information
gap junction alpha-1 protein

Similar Products

Product Notes

The GJA1 (Catalog #AAA198095) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJA1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GJA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GJA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYLAHVFYVM RKEEKLNKKE EELKVAQTDG VNVDMHLKQI EIKKFKYGIE. It is sometimes possible for the material contained within the vial of "GJA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.